DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15253 and nas-33

DIOPT Version :9

Sequence 1:NP_609758.1 Gene:CG15253 / 34916 FlyBaseID:FBgn0028948 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_509086.2 Gene:nas-33 / 186987 WormBaseID:WBGene00003551 Length:644 Species:Caenorhabditis elegans


Alignment Length:234 Identity:76/234 - (32%)
Similarity:117/234 - (50%) Gaps:22/234 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 ELTAGYIEGDMVPSGSSRNIWRNETYR-----------WPNRIIYYHINSYIDEEHRNHIVSAIQ 83
            ::.|...|.||..:.|..|......:|           |...|.|..:::  |...::.|.:.::
 Worm   164 KIAAVMFESDMALTVSQMNKVAQNGFRVKRKMNLNGTTWSRNIPYRFLDT--DGNWQSQITNGLR 226

  Fly    84 KIESISCLTFKEATTDQKYYVNVTSEEGGCFSYIGYLNRVQQLNLQNNEIGVGCFRLYTIVHEFL 148
            ..|..:|:.|........|.  |.|:..||:|.:|.|...|:::     ||.||..|..|.||..
 Worm   227 HYERNTCIRFSLNGGGSDYL--VFSKGEGCYSSVGRLGGPQEIS-----IGDGCETLGIITHEVG 284

  Fly   149 HALGFFHQQSAADRDDYVQIVEENITEGMEFNFDKYTEETVNDFGEKYDYGSVMHYGPYAFSKNG 213
            |||||:|:|:..:||.||:|..:|...|:|..|||.:...||::...|||||||||||.:|||:.
 Worm   285 HALGFWHEQARPERDSYVRINRQNAINGLEGQFDKRSWSEVNEYSLPYDYGSVMHYGPKSFSKSS 349

  Fly   214 E-RTILALEEGKEDVIGQRLELSETDIRKLNAIYKCPTV 251
            . .|:..::....:.||.|:|.|..|::.||..: |..:
 Worm   350 TMNTVEPVDPAFINTIGNRVEPSFLDLKLLNTAF-CSNI 387

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15253NP_609758.1 Astacin 55..250 CDD:279708 70/206 (34%)
ZnMc_astacin_like 59..246 CDD:239807 67/187 (36%)
nas-33NP_509086.2 Astacin 200..386 CDD:279708 69/195 (35%)
ZnMc_astacin_like 203..381 CDD:239807 66/186 (35%)
CUB 442..527 CDD:294042
TSP1 553..595 CDD:214559
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D681837at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10127
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.