DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15253 and nas-16

DIOPT Version :10

Sequence 1:NP_609758.1 Gene:CG15253 / 34916 FlyBaseID:FBgn0028948 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_505889.2 Gene:nas-16 / 186922 WormBaseID:WBGene00003535 Length:337 Species:Caenorhabditis elegans


Alignment Length:183 Identity:51/183 - (27%)
Similarity:84/183 - (45%) Gaps:37/183 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    81 AIQKIESISCLTFKEATT--DQKYYVNVTSEEGGCFSYIGYLNRVQQLNLQNNEIGVGCFRLYTI 143
            |:..|.|.:|:||:|..|  .:..:|:.|.    |.||:|.:|.||::...:     .|.|..:.
 Worm     4 AMNFISSQTCVTFEENCTISTRIKFVDSTF----CASYVGMINSVQEIYFPD-----WCMRFGSA 59

  Fly   144 VHEFLHALGFFHQQSAADRDDYVQIVEENITEGMEFNFDKYTEETVN------DFG---EKYDYG 199
            |||.:||||..|..:..|||:::.:           |.:|..|:..|      .|.   ..|:||
 Worm    60 VHELMHALGVLHTHARFDRDNFLNV-----------NLNKDDEDDSNFEIVSPPFSINVVPYEYG 113

  Fly   200 SVMHYGPYAFSKNGERTILALEEGKEDVIGQRLELSETDIRKLNAIY--KCPT 250
            |.:|   |....:|..::|..:......:|.| .::..|:..:|..|  |||:
 Worm   114 STLH---YTADVSGTNSLLPKQMEYYRTLGNR-RVTFYDMLTINTAYNCKCPS 162

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15253NP_609758.1 ZnMc_astacin_like 59..246 CDD:239807 47/175 (27%)
nas-16NP_505889.2 Astacin 1..160 CDD:426242 48/179 (27%)

Return to query results.
Submit another query.