DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15253 and nas-31

DIOPT Version :9

Sequence 1:NP_609758.1 Gene:CG15253 / 34916 FlyBaseID:FBgn0028948 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_001023994.1 Gene:nas-31 / 186493 WormBaseID:WBGene00003549 Length:611 Species:Caenorhabditis elegans


Alignment Length:241 Identity:76/241 - (31%)
Similarity:115/241 - (47%) Gaps:44/241 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 EGDMV--------------------PSGSSRNIWRNETY---RWPNRIIYYHINSYIDEEHRNHI 78
            :||||                    .|.:.|..:|:..|   .|.:.:.||:     |......|
 Worm   128 QGDMVLTDDQIATILEARDETTVSTASRARRQAYRDRYYPSTTWGSSVYYYY-----DRTATPKI 187

  Fly    79 VSAIQKI----ESISCLTFKEATTDQKYYVN-VTSEEG-GCFSYIGYLNRVQQLNLQNNEIGVGC 137
            |.|.::.    ::::|:...:::|    .:| :...:| ||:||:|.::.||.|:|     |.||
 Worm   188 VKAFEQAVAFWQNVTCINIMQSST----AINRIRVFKGQGCYSYVGRISGVQDLSL-----GTGC 243

  Fly   138 FRLYTIVHEFLHALGFFHQQSAADRDDYVQIVEENITEGMEFNFDKYTEETVNDFGEKYDYGSVM 202
            ....|..||..|||||||.||..|||:|:.|...||.......|||.|..|..::|..|||||:|
 Worm   244 EEFGTAAHELGHALGFFHTQSRYDRDNYISINYANIDPSYVEQFDKETSNTNFNYGMPYDYGSIM 308

  Fly   203 HYGPYAFSKNGERTILALEEGKEDVIGQRLELSETDIRKLNAIYKC 248
            .||..:.|.|.:.|::|.:...:|.:|... :...||..:|..|||
 Worm   309 QYGATSASSNDKATMIARDTEYQDTMGSDF-VGFYDISMMNEHYKC 353

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15253NP_609758.1 Astacin 55..250 CDD:279708 69/203 (34%)
ZnMc_astacin_like 59..246 CDD:239807 64/192 (33%)
nas-31NP_001023994.1 Astacin 169..355 CDD:279708 68/200 (34%)
ZnMc_astacin_like 175..351 CDD:239807 64/190 (34%)
ShKT 532..564 CDD:214586
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10127
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.