DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15253 and nas-29

DIOPT Version :10

Sequence 1:NP_609758.1 Gene:CG15253 / 34916 FlyBaseID:FBgn0028948 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_494953.3 Gene:nas-29 / 186488 WormBaseID:WBGene00003547 Length:532 Species:Caenorhabditis elegans


Alignment Length:233 Identity:69/233 - (29%)
Similarity:104/233 - (44%) Gaps:30/233 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 TDPELTAGYIEGDMVPSGSSRNIWRNETYRWPNRIIYYHINSYIDEEHRNHIVSAIQKIESISCL 91
            ||......|::.: .|:    .||:|.        :.:..:..:....:..|:.|:......:|:
 Worm   129 TDRTKRQAYLDNN-YPA----TIWKNG--------VAFMFHESLTPIAKTAILKAVHFWYRETCI 180

  Fly    92 TFKEATTDQKYYVNVTSEEGGCFSYIGYLNRVQQLNLQNNEIGVGCFRLYTIVHEFLHALGFFHQ 156
            .| ...|.||.|:.....:.||:|.:|   |......|...||.||.......||..||||.||:
 Worm   181 EF-HPRTFQKEYLLFIGNDDGCWSTVG---RDASQGKQVVSIGNGCEHFGVTSHELAHALGIFHE 241

  Fly   157 QSAADRDDYV----QIVEENITEGMEFNFDKYTEETVNDFGEKYDYGSVMHYGPYAFSK-NGERT 216
            ||..|||:.|    ::||.::.    |||.|.:...::.:|..||.||||||.|..||. ....|
 Worm   242 QSRFDRDESVVFNPRVVERDLL----FNFAKISPRQMSTYGLPYDIGSVMHYTPTEFSNIPSIPT 302

  Fly   217 ILALEEGKEDVIGQRLELSETDIRKLNAIY----KCPT 250
            :.|::...:..:||....|..|:..:|..|    ||||
 Worm   303 LAAIDTNLQQTMGQLEGPSFVDVHIMNQHYQCQEKCPT 340

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15253NP_609758.1 ZnMc_astacin_like 59..246 CDD:239807 57/191 (30%)
nas-29NP_494953.3 Astacin 145..336 CDD:426242 61/206 (30%)
CUB 404..491 CDD:214483
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.