DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15253 and nas-1

DIOPT Version :9

Sequence 1:NP_609758.1 Gene:CG15253 / 34916 FlyBaseID:FBgn0028948 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_499768.2 Gene:nas-1 / 185811 WormBaseID:WBGene00003520 Length:270 Species:Caenorhabditis elegans


Alignment Length:278 Identity:72/278 - (25%)
Similarity:125/278 - (44%) Gaps:51/278 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LLLVVVNVAWAAP----------------SIRIETDPELTAGYIEGDMVPSGSSRNIWRN----- 52
            :|.:||::..|.|                |...|||      :....::|:.::|.: |:     
 Worm     1 MLPIVVSILLATPLALCQAPFWMPNMQQFSFLTETD------FRNALLLPTTNTRRV-RSLYHDM 58

  Fly    53 -----------------ETYRWPNRIIYYHINSYIDEEHRNHIVSAIQKIESISCLTFKEATTDQ 100
                             |..:|||..:.|.:::......|..:..|.......:|:.|...:...
 Worm    59 RIPFQRFKRGGGVAVAAEKDKWPNGRVPYILSAAYTSAQRAVLARAFDTYAKRTCIRFVPKSPAD 123

  Fly   101 KYYVNVTSEEGGCFSYIGYLNRVQQLNLQNNEIGVGCFRLYTIVHEFLHALGFFHQQSAADRDDY 165
            |.|: |..:..||::....:...||::|.:.     |....||:||.:|.:||.|:....|||.|
 Worm   124 KDYI-VIQKLDGCYADFSRVGGRQQVSLADE-----CIDYATIIHELMHVIGFIHEHQREDRDSY 182

  Fly   166 VQIVEENITEGMEFNFDKYTEETVNDFGEKYDYGSVMHYGPYAFSKNGERTILALEEGKEDVIGQ 230
            |.|:.:|:.:|...:|||.:...::.:||.|||.|:|||.....|:||:.||.|.......::|:
 Worm   183 VSILYQNVIQGANTDFDKLSNLGLSYYGEHYDYSSIMHYEANEGSRNGKNTIEAKNSHFTAIMGK 247

  Fly   231 RLELSETDIRKLNAIYKC 248
            ..:.|.:|:|::|..|||
 Worm   248 ASDFSTSDLRRVNRAYKC 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15253NP_609758.1 Astacin 55..250 CDD:279708 59/194 (30%)
ZnMc_astacin_like 59..246 CDD:239807 54/186 (29%)
nas-1NP_499768.2 Astacin 79..266 CDD:279708 59/193 (31%)
ZnMc_astacin_like 82..263 CDD:239807 54/186 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG49330
OrthoDB 1 1.010 - - D472790at33208
OrthoFinder 1 1.000 - - FOG0000240
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10127
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.930

Return to query results.
Submit another query.