DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15253 and nas-28

DIOPT Version :9

Sequence 1:NP_609758.1 Gene:CG15253 / 34916 FlyBaseID:FBgn0028948 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_498342.3 Gene:nas-28 / 185658 WormBaseID:WBGene00003546 Length:497 Species:Caenorhabditis elegans


Alignment Length:208 Identity:74/208 - (35%)
Similarity:109/208 - (52%) Gaps:11/208 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 SSRNIWRNETYRWPNRI-IYYHINSYIDEEHRNHIVSAIQKIESISCLTFKEATTDQKYYVNVTS 108
            |.|....:.|..|...: |:|..::.:...:..::..|||.....|||:|||....:...  ..|
 Worm   118 SKRQAIVDTTNFWSVSVPIFYQFDTKLSATNIANVRKAIQFWNDNSCLSFKEDNNAKNRL--FLS 180

  Fly   109 EEGGCFSYIGYLNRVQQLNLQNNEIGVG--CFRLYTIVHEFLHALGFFHQQSAADRDDYVQIVEE 171
            ..|||:||:|     :|:::....:.||  |....|..||.:||:||:||||.||||:||.:...
 Worm   181 SAGGCWSYVG-----KQVDMPYQMVSVGPNCDTFGTATHELMHAIGFWHQQSRADRDNYVYVDFS 240

  Fly   172 NITEGMEFNFDKYTEETVNDFGEKYDYGSVMHYGPYAFSKNGER-TILALEEGKEDVIGQRLELS 235
            ||.....:||.|...:........|||||||.|.||||:.:..: ||||.|.|.::.:|||...:
 Worm   241 NIIPSQAYNFQKMAVDQAQLLNLPYDYGSVMQYYPYAFAVDSSKYTILAKENGFQNSMGQREAPA 305

  Fly   236 ETDIRKLNAIYKC 248
            .:||..:|.:|.|
 Worm   306 FSDIIGVNKLYNC 318

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15253NP_609758.1 Astacin 55..250 CDD:279708 71/198 (36%)
ZnMc_astacin_like 59..246 CDD:239807 68/190 (36%)
nas-28NP_498342.3 Astacin 135..320 CDD:279708 70/191 (37%)
ZnMc_astacin_like 135..316 CDD:239807 68/187 (36%)
CUB 393..480 CDD:214483
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D681837at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10127
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.