DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15253 and nas-13

DIOPT Version :9

Sequence 1:NP_609758.1 Gene:CG15253 / 34916 FlyBaseID:FBgn0028948 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_510549.3 Gene:nas-13 / 185492 WormBaseID:WBGene00003532 Length:450 Species:Caenorhabditis elegans


Alignment Length:234 Identity:93/234 - (39%)
Similarity:133/234 - (56%) Gaps:28/234 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 EGDMVPSG-SSRNI---------------WRN---ETY-RWPNRIIYYHINSYIDEEHRNHIVSA 81
            |||:..|| :||:|               .||   :|| :|....|.|.|:|......|:.|..|
 Worm    79 EGDIANSGLNSRSINTFFGDSPLFGIFGVQRNAVRQTYLKWEQARIPYTISSQYSSYSRSKIAEA 143

  Fly    82 IQKIESISCLTFKEATTDQKYYVNVTSEEGGCFSYIGYLNRVQQLNLQNNEIGVGCFRLYTIVHE 146
            |::....:|:.|...:.....|:::..:: ||:|.:|.:...|.::|     |.||.:...|:||
 Worm   144 IEEYRKKTCIDFSPKSAGDLDYIHIVPDD-GCYSLVGRIGGKQPVSL-----GDGCIQKGIIIHE 202

  Fly   147 FLHALGFFHQQSAADRDDYVQIVEENITEGMEFNFDKYTEETVNDFGEKYDYGSVMHYGPYAFSK 211
            .:||:||||:||.||||:||:|...|:..|::..||||:...::..|.||||||||||.|.||||
 Worm   203 LMHAVGFFHEQSRADRDEYVKINWSNVEAGLQDQFDKYSLNMIDHLGTKYDYGSVMHYAPTAFSK 267

  Fly   212 NGERTILALEEGKEDVIGQRLELSETDIRKLNAIYKCPT 250
            ||:.||..:|:..|  ||||...||.||.|:|.:|.|||
 Worm   268 NGKPTIEPIEKNVE--IGQRAGFSENDIYKINMLYNCPT 304

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15253NP_609758.1 Astacin 55..250 CDD:279708 80/195 (41%)
ZnMc_astacin_like 59..246 CDD:239807 76/186 (41%)
nas-13NP_510549.3 Astacin 118..304 CDD:279708 79/193 (41%)
ZnMc_astacin_like 122..300 CDD:239807 76/185 (41%)
ShK 367..404 CDD:279838
ShK 414..450 CDD:279838
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3714
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S6346
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D472790at33208
OrthoFinder 1 1.000 - - FOG0000240
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10127
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
87.870

Return to query results.
Submit another query.