DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15253 and nas-14

DIOPT Version :9

Sequence 1:NP_609758.1 Gene:CG15253 / 34916 FlyBaseID:FBgn0028948 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_502533.2 Gene:nas-14 / 184247 WormBaseID:WBGene00003533 Length:503 Species:Caenorhabditis elegans


Alignment Length:229 Identity:83/229 - (36%)
Similarity:124/229 - (54%) Gaps:15/229 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 RIETDPELTAGYIEGDMV---PSGSSRNIWRNETYRWPNRIIYYHINSYIDEEHRNHIVSAIQKI 85
            |:..||     .::.|.:   |..|:.|:.......||...:.|.:...:..:.|..|..|..:.
 Worm    94 RLRDDP-----LLDEDEIFRKPFHSALNLVTYPDKLWPEGQVPYMLEEGMTNDQRTAIAQAFDEY 153

  Fly    86 ESISCLTFKEATTDQKYYVNVTSEEG-GCFSYIGYLNRVQQLNLQNNEIGVGCFRLYTIVHEFLH 149
            ::.:|:.|...|.|...|:.|..... ||.||:|.....|.::|:.::    ||....|.||.:|
 Worm   154 KTKTCVRFVPKTDDDFDYIYVKRNVAFGCSSYVGRAGGNQTVSLEVDK----CFSKGIIAHELMH 214

  Fly   150 ALGFFHQQSAADRDDYVQIVEENITEGMEFNFDKYTEETVNDFGEKYDYGSVMHYGPYAFSKNGE 214
            ||||||:.|..||||:|.|.|:||..||..||:||..:.::..|..|||.|||||...|||:||:
 Worm   215 ALGFFHEHSRTDRDDFVDINEDNIRPGMMRNFEKYPRKIIDSLGMPYDYESVMHYHKLAFSRNGK 279

  Fly   215 RTILALEEGKEDVIGQRLELSETDIRKLNAIYKC 248
            .||:. ::.:.|| |||.:|||.|.:|:|.:|:|
 Worm   280 PTIIP-KDNEADV-GQRYKLSEMDSKKVNKLYQC 311

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15253NP_609758.1 Astacin 55..250 CDD:279708 76/195 (39%)
ZnMc_astacin_like 59..246 CDD:239807 72/187 (39%)
nas-14NP_502533.2 Astacin 123..313 CDD:279708 76/195 (39%)
ZnMc_astacin_like 128..309 CDD:239807 72/186 (39%)
ShKT 380..414 CDD:214586
ShK 468..503 CDD:279838
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D472790at33208
OrthoFinder 1 1.000 - - FOG0000240
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.