DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15253 and nas-7

DIOPT Version :9

Sequence 1:NP_609758.1 Gene:CG15253 / 34916 FlyBaseID:FBgn0028948 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_495552.2 Gene:nas-7 / 182368 WormBaseID:WBGene00003526 Length:382 Species:Caenorhabditis elegans


Alignment Length:260 Identity:80/260 - (30%)
Similarity:125/260 - (48%) Gaps:28/260 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 LLVVVNVAWAAPSIRIE--------TDPELTAGYIEGDMV---------PSGSSRNIWRNETYRW 57
            :||:.:   :..|:.:|        |..||...:|..::|         |....||........|
 Worm    28 MLVISD---STDSLNLEDFEFADKLTREELFGKHIPVEVVNDFKSDIRLPRRHKRNGVSRAAKLW 89

  Fly    58 PNRIIYYHINSYIDEEHRNHIVSAIQKIESISCLTFKEATTDQKYYVNVTSEEGGCFSYIGYLNR 122
            ||..|.|.|:.:.....|..:..|:::....:|:.|....|.:..|:.: .:..||||.:|..:.
 Worm    90 PNARIPYAISPHYSPHERALLAKAVKQYHEKTCIRFVPRQTGEPDYLFI-GKVDGCFSEVGRTSG 153

  Fly   123 VQQLNLQNNEIGVGCFRLYTIVHEFLHALGFFHQQSAADRDDYVQIVEENITEGMEFNFDKYTEE 187
            ||.|:|.|     ||....||:||.:|.:||:|:....|||:::.|:.:||..|....|.|....
 Worm   154 VQVLSLDN-----GCMEYATIIHEMMHVVGFYHEHERWDRDNFIDIIWQNIDRGALDQFGKVDLS 213

  Fly   188 TVNDFGEKYDYGSVMHYGPYAFSKNGERTILALEEGKEDVIGQRLELSETDIRKLNAIYKCPTVK 252
            ..:.:|:.|||.|::||...||||||..|:  |.:.|...||...:.|:.||.|:|.:|.||..|
 Worm   214 KTSYYGQPYDYKSILHYDSLAFSKNGFPTM--LPKVKSATIGNARDFSDVDISKINRMYNCPVEK 276

  Fly   253  252
             Worm   277  276

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15253NP_609758.1 Astacin 55..250 CDD:279708 66/194 (34%)
ZnMc_astacin_like 59..246 CDD:239807 62/186 (33%)
nas-7NP_495552.2 Astacin 87..274 CDD:279708 66/194 (34%)
ZnMc_astacin_like 91..270 CDD:239807 62/186 (33%)
ShK 347..382 CDD:279838
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D472790at33208
OrthoFinder 1 1.000 - - FOG0000240
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10127
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.920

Return to query results.
Submit another query.