DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15253 and nas-7

DIOPT Version :10

Sequence 1:NP_609758.1 Gene:CG15253 / 34916 FlyBaseID:FBgn0028948 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_495552.2 Gene:nas-7 / 182368 WormBaseID:WBGene00003526 Length:382 Species:Caenorhabditis elegans


Alignment Length:260 Identity:80/260 - (30%)
Similarity:125/260 - (48%) Gaps:28/260 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 LLVVVNVAWAAPSIRIE--------TDPELTAGYIEGDMV---------PSGSSRNIWRNETYRW 57
            :||:.:   :..|:.:|        |..||...:|..::|         |....||........|
 Worm    28 MLVISD---STDSLNLEDFEFADKLTREELFGKHIPVEVVNDFKSDIRLPRRHKRNGVSRAAKLW 89

  Fly    58 PNRIIYYHINSYIDEEHRNHIVSAIQKIESISCLTFKEATTDQKYYVNVTSEEGGCFSYIGYLNR 122
            ||..|.|.|:.:.....|..:..|:::....:|:.|....|.:..|:.: .:..||||.:|..:.
 Worm    90 PNARIPYAISPHYSPHERALLAKAVKQYHEKTCIRFVPRQTGEPDYLFI-GKVDGCFSEVGRTSG 153

  Fly   123 VQQLNLQNNEIGVGCFRLYTIVHEFLHALGFFHQQSAADRDDYVQIVEENITEGMEFNFDKYTEE 187
            ||.|:|.|     ||....||:||.:|.:||:|:....|||:::.|:.:||..|....|.|....
 Worm   154 VQVLSLDN-----GCMEYATIIHEMMHVVGFYHEHERWDRDNFIDIIWQNIDRGALDQFGKVDLS 213

  Fly   188 TVNDFGEKYDYGSVMHYGPYAFSKNGERTILALEEGKEDVIGQRLELSETDIRKLNAIYKCPTVK 252
            ..:.:|:.|||.|::||...||||||..|:  |.:.|...||...:.|:.||.|:|.:|.||..|
 Worm   214 KTSYYGQPYDYKSILHYDSLAFSKNGFPTM--LPKVKSATIGNARDFSDVDISKINRMYNCPVEK 276

  Fly   253  252
             Worm   277  276

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15253NP_609758.1 ZnMc_astacin_like 59..246 CDD:239807 62/186 (33%)
nas-7NP_495552.2 Astacin 87..274 CDD:426242 66/194 (34%)
ShK 347..382 CDD:426319
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.