DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15253 and nas-4

DIOPT Version :9

Sequence 1:NP_609758.1 Gene:CG15253 / 34916 FlyBaseID:FBgn0028948 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_001254938.1 Gene:nas-4 / 182259 WormBaseID:WBGene00003523 Length:365 Species:Caenorhabditis elegans


Alignment Length:240 Identity:84/240 - (35%)
Similarity:139/240 - (57%) Gaps:19/240 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 IRIETDPELTAGYIEGDMVPSGSSRNIWRN---------ETY-RWPNRIIYYHINSYIDEEHRNH 77
            |:::.||.: ..|.|||::.....:.:..|         :.| ||||..|.|.::|......|:.
 Worm    61 IKVKDDPTI-GNYSEGDILLESPKKFVEENNKLGRNAIKQIYRRWPNNEIPYTLSSQYGSYARSV 124

  Fly    78 IVSAIQKIESISCLTFKEATTDQKY-YVNVTSEEGGCFSYIGYLNRVQQLNLQNNEIGVGCFRLY 141
            |.:|:.:..:.:|:.|......:.: |:.:..:| ||:|.:|.....|.::|.:     ||.::.
 Worm   125 IANAMNEYHTKTCVKFVARDPSKHHDYLWIHPDE-GCYSLVGKTGGKQPVSLDS-----GCIQVG 183

  Fly   142 TIVHEFLHALGFFHQQSAADRDDYVQIVEENITEGMEFNFDKYTEETVNDFGEKYDYGSVMHYGP 206
            |||||.:||:||||:||..|||.|:.:|.:|:..|.:..|:||....::...|.|||.|:|||||
 Worm   184 TIVHELMHAVGFFHEQSRQDRDSYIDVVWQNVMNGADDQFEKYNLNVISHLDEPYDYASIMHYGP 248

  Fly   207 YAFSKNGERTILALEEGKEDVIGQRLELSETDIRKLNAIYKCPTV 251
            ||||.:|::|::..:.|.|. :|||::.|:.|:||:|.:|.||.|
 Worm   249 YAFSGSGKKTLVPKKSGSER-MGQRVKFSDIDVRKINKLYNCPGV 292

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15253NP_609758.1 Astacin 55..250 CDD:279708 74/196 (38%)
ZnMc_astacin_like 59..246 CDD:239807 68/187 (36%)
nas-4NP_001254938.1 Astacin 102..290 CDD:279708 72/194 (37%)
ZnMc_astacin_like 106..287 CDD:239807 68/187 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG49330
OrthoDB 1 1.010 - - D472790at33208
OrthoFinder 1 1.000 - - FOG0000240
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.930

Return to query results.
Submit another query.