DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15253 and nas-6

DIOPT Version :9

Sequence 1:NP_609758.1 Gene:CG15253 / 34916 FlyBaseID:FBgn0028948 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_001040902.1 Gene:nas-6 / 181796 WormBaseID:WBGene00003525 Length:344 Species:Caenorhabditis elegans


Alignment Length:280 Identity:92/280 - (32%)
Similarity:139/280 - (49%) Gaps:37/280 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MCYYSILLLLLVVVNVAWAAPSI--------RIETDPELT------AGYIEGDM---------VP 42
            |..:.:||...:|..|..:.||.        .|..|..:|      :|..:||:         :|
 Worm     1 MLDHVLLLTYCLVSTVVRSQPSADVFRSFAGYIPEDHRVTHHEWQNSGKFQGDIDGVDPNLLKLP 65

  Fly    43 SGSSR-NIWRNETYRWPNRIIYYHINSYIDEEHRNHIVSAIQKIESISCLTF--KEATTDQKYYV 104
            .|... |..:|:...|...:|.|.:::.........:..|.......:|:.|  :|..||   |:
 Worm    66 EGPVLFNALKNKQLTWEGGVIPYEMDTAFSPNEIKILEKAFDSYRRTTCIRFEKREGQTD---YL 127

  Fly   105 NVTSEEG-GCFSYIGYLNRVQQLNLQNNEIGVGCFRLYTIVHEFLHALGFFHQQSAADRDDYVQI 168
            |:.  :| ||:|.:|.....|:::|     |.|||....||||.:|::||:|:.|.|||||:::|
 Worm   128 NIV--KGYGCYSQVGRTGGKQEISL-----GRGCFFHEIIVHELMHSVGFWHEHSRADRDDHIKI 185

  Fly   169 VEENITEGMEFNFDKYTEETVNDFGEKYDYGSVMHYGPYAFSKNGERTILALEEGKEDVIGQRLE 233
            ..:||..||:..|||.:....:..||.|||.|:|||...|||:||..||..:|.|...|||..::
 Worm   186 NWDNILPGMKSQFDKISAVLQDLQGENYDYKSIMHYDSTAFSRNGRNTIETVENGFTQVIGTAMD 250

  Fly   234 LSETDIRKLNAIYKCPTVKE 253
            ||..||.|:|.:|.|.|.|:
 Worm   251 LSPLDIVKINKLYSCKTKKK 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15253NP_609758.1 Astacin 55..250 CDD:279708 73/197 (37%)
ZnMc_astacin_like 59..246 CDD:239807 70/189 (37%)
nas-6NP_001040902.1 Astacin 80..265 CDD:279708 72/194 (37%)
ZnMc_astacin_like 83..263 CDD:239807 70/189 (37%)
ShK 299..334 CDD:279838
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D472790at33208
OrthoFinder 1 1.000 - - FOG0000240
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_112325
Panther 1 1.100 - - O PTHR10127
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.920

Return to query results.
Submit another query.