Sequence 1: | NP_609758.1 | Gene: | CG15253 / 34916 | FlyBaseID: | FBgn0028948 | Length: | 253 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_510440.1 | Gene: | hch-1 / 181564 | WormBaseID: | WBGene00001828 | Length: | 605 | Species: | Caenorhabditis elegans |
Alignment Length: | 262 | Identity: | 82/262 - (31%) |
---|---|---|---|
Similarity: | 121/262 - (46%) | Gaps: | 52/262 - (19%) |
- Green bases have known domain annotations that are detailed below.
Fly 24 RIETDPELTAGYIEGDMVPSGSSRNI---------W-----RNE---------------TYRWPN 59
Fly 60 RIIYYHINSYIDEE---HRNHIVSAIQKIESISCLTFKEATTDQKYYVNVTSEE-------GGCF 114
Fly 115 SYIGYLNRVQQLNLQNNEIGVGCFRLYTIVHEFLHALGFFHQQSAADRDDYVQIVEENITEGMEF 179
Fly 180 NFDKYTEETVNDFGEKYDYGSVMHYGPYAFSKNGERTILALEEGKEDVIGQRLELSETDIRKLNA 244
Fly 245 IY 246 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG15253 | NP_609758.1 | Astacin | 55..250 | CDD:279708 | 71/202 (35%) |
ZnMc_astacin_like | 59..246 | CDD:239807 | 68/196 (35%) | ||
hch-1 | NP_510440.1 | Astacin | 132..323 | CDD:279708 | 71/202 (35%) |
ZnMc_astacin_like | 135..320 | CDD:239807 | 68/197 (35%) | ||
CUB | 386..466 | CDD:214483 | |||
TSP1 | 533..565 | CDD:214559 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG3714 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | O | PTHR10127 |
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 1 | 1.000 | - | - | ||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
4 | 3.910 |