DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15253 and nas-10

DIOPT Version :10

Sequence 1:NP_609758.1 Gene:CG15253 / 34916 FlyBaseID:FBgn0028948 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_001257126.1 Gene:nas-10 / 181287 WormBaseID:WBGene00003529 Length:540 Species:Caenorhabditis elegans


Alignment Length:233 Identity:68/233 - (29%)
Similarity:112/233 - (48%) Gaps:36/233 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 EGDMVPSGSSR----NIW--RNETYRWPNRI-IYYHINSYIDEEHRNHIVSAIQKIESISCLTFK 94
            ||.:...||::    :|:  :|...:||:.. |.|..:|.:|...:|.:..||.:||..:|:.||
 Worm   279 EGAIPMPGSAKAKRASIFFEQNLIQKWPSTSPIPYTFDSSLDNLDQNDVRGAISEIEQKTCIRFK 343

  Fly    95 E-ATTDQKYYVNVTSEEGGCFSYIGYLNRVQ-----QLNLQ-NNEIGVGCFRLYTIVHEFLHALG 152
            . |:..:..::|........|..:.|:.||:     .|:.| .|..|:.       |||.:||||
 Worm   344 YFASPPKGNHINYQKVNSPSFCGLSYIGRVEPANPVYLSFQCGNGRGIA-------VHETMHALG 401

  Fly   153 FFHQQSAADRDDYVQIVEENITEGMEFNFDKYTEETVND------FGEKYDYGSVMHYGPYAFSK 211
            ..||....|||.::::...||      |..:|....|.|      :|.||.|.|:|||..|..:.
 Worm   402 VNHQHLRMDRDKHIKVDWSNI------NPQQYDAFVVADSKLYTTYGVKYAYDSIMHYNAYTGAV 460

  Fly   212 N-GERTILAL--EEGKEDVIGQRLELSETDIRKLNAIY 246
            | .:.|::.|  ::....::|||.::|..|:..||.:|
 Worm   461 NIAKPTMIPLVNQQANIGLLGQRAKMSNADVEILNKMY 498

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15253NP_609758.1 ZnMc_astacin_like 59..246 CDD:239807 59/203 (29%)
nas-10NP_001257126.1 Astacin 303..501 CDD:426242 62/209 (30%)
ShK 503..540 CDD:426319
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.