DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15253 and nas-37

DIOPT Version :9

Sequence 1:NP_609758.1 Gene:CG15253 / 34916 FlyBaseID:FBgn0028948 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_001024413.1 Gene:nas-37 / 181208 WormBaseID:WBGene00003553 Length:765 Species:Caenorhabditis elegans


Alignment Length:236 Identity:87/236 - (36%)
Similarity:118/236 - (50%) Gaps:25/236 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 ETDPELTAGYIEGDMVPSGSSRNIWRNETYR-----WPNRIIYYHINSYIDEE-HRNHIVSAIQK 84
            |.|..||....|..:..|.|.|:  |.:.:.     |||..|.|..  |..|| .|..|.|||:.
 Worm    90 ENDIILTLPQAESLLSESNSPRS--RRQAHPDPRNFWPNLTISYEF--YGGEETWRQLIRSAIRH 150

  Fly    85 IESISCLTFKEATTDQ---KYYVNVTSEEGGCFSYIGYLNRVQQLNLQNNEIGVGCFRLYTIVHE 146
            :|...|..|||...|:   :||     ...||:|.:|.:...|.::     ||.||..|..:.||
 Worm   151 VEQNVCFKFKENGGDRDGLRYY-----RGNGCWSNVGRVGGRQLVS-----IGYGCDSLGIVSHE 205

  Fly   147 FLHALGFFHQQSAADRDDYVQIVEENITEGMEFNFDKYTEETVNDFGEKYDYGSVMHYGPYAFSK 211
            .|||||.:|:||..|||:::.||.:.||.|.|.||.|.|....::.|:.||.|||||||..:|:.
 Worm   206 TLHALGLWHEQSRDDRDNFISIVADKITRGTEGNFAKRTAANSDNLGQPYDLGSVMHYGAKSFAY 270

  Fly   212 N-GERTILALEEGKEDVIGQRLELSETDIRKLNAIYKCPTV 251
            : ...||...:...::.||||..||..|.:.:|..| |..|
 Worm   271 DWSSDTIKTRDWRYQNTIGQRDGLSFKDAKMINTRY-CSNV 310

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15253NP_609758.1 Astacin 55..250 CDD:279708 77/204 (38%)
ZnMc_astacin_like 59..246 CDD:239807 73/191 (38%)
nas-37NP_001024413.1 Astacin 122..309 CDD:279708 77/199 (39%)
ZnMc_astacin_like 126..306 CDD:239807 73/191 (38%)
CUB 370..455 CDD:214483
TSP1 579..626 CDD:214559
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D681837at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10127
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.