DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15253 and nas-11

DIOPT Version :9

Sequence 1:NP_609758.1 Gene:CG15253 / 34916 FlyBaseID:FBgn0028948 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_001024789.1 Gene:nas-11 / 180938 WormBaseID:WBGene00003530 Length:579 Species:Caenorhabditis elegans


Alignment Length:246 Identity:71/246 - (28%)
Similarity:109/246 - (44%) Gaps:42/246 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 AAP-SIRIETDPELTAGYIEGDMVPSGSSRNIWRNETYRW-PNRIIYYHINSYIDEEHRNHIVSA 81
            ||| |.|::.    :|.|.||:::.             :| |:..|.|.::|.:::..:|.:.:|
 Worm   319 AAPGSSRLKK----SALYFEGNLIK-------------KWDPSSPIRYVLDSSLEDLDKNDVRAA 366

  Fly    82 IQKIESISCLTFKE----ATTDQKYYVNVTSEEGGCFSYIGYLNRVQQLNLQ---NNEIGVGCFR 139
            |.:||..:|:.|||    .|.....|..|.|......||:|..:....:.|.   :|..||.   
 Worm   367 IYEIEKNTCIRFKELSSPPTGSHIVYYKVDSPTFCGLSYVGRADPANPVYLSFGCDNNKGVA--- 428

  Fly   140 LYTIVHEFLHALGFFHQQSAADRDDYVQIVEENITEGMEFNFDKYTEETVNDFGEKYDYGSVMHY 204
                :||.:||||..||....|||.::.|...||.......|.....:....:|.||.|.|:|||
 Worm   429 ----IHETMHALGVAHQHLRNDRDQFITINWSNIDPQQYDAFVVVDSKLYTSYGVKYAYDSIMHY 489

  Fly   205 GPYAFSKN------GERTILALEEGKEDVIGQRLELSETDIRKLNAIYKCP 249
            ..|..::|      ..:|..|:   ...|:|||.::..|||..|..:|..|
 Worm   490 NGYTAAQNIAIPTMNPKTNSAV---NLKVLGQRQKMGTTDIELLKKMYCQP 537

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15253NP_609758.1 Astacin 55..250 CDD:279708 62/209 (30%)
ZnMc_astacin_like 59..246 CDD:239807 58/199 (29%)
nas-11NP_001024789.1 Astacin 339..537 CDD:279708 61/220 (28%)
ZnMc_astacin_like 346..534 CDD:239807 58/197 (29%)
ShK 538..575 CDD:279838 71/246 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D681837at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10127
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.