DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15253 and nas-9

DIOPT Version :9

Sequence 1:NP_609758.1 Gene:CG15253 / 34916 FlyBaseID:FBgn0028948 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_741532.1 Gene:nas-9 / 178875 WormBaseID:WBGene00003528 Length:546 Species:Caenorhabditis elegans


Alignment Length:238 Identity:66/238 - (27%)
Similarity:106/238 - (44%) Gaps:34/238 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 ELTAGYIEGDMVP-SG--------SSRNIWRNETYRWPNRIIYYHINSYIDEEHRNHIVSAIQKI 85
            ::.||...|..|| ||        ...:||:.         |.|.::..::|..:..|..|:.:|
 Worm   287 DVGAGGGGGGRVPRSGVFFQESAVQKWDIWKP---------IQYTLDDSLEESDKKDIRDALHEI 342

  Fly    86 ESISCLTFKEATTDQKYYVNVTSEEGGCFSYIGYLNRVQ-----QLNLQ-NNEIGVGCFRLYTIV 144
            ...:|:.|:...|.:.|::|....:...|..:.|:.|..     .|:.| .:..||.       :
 Worm   343 SINTCILFRYNATPKGYHLNYMKVDSTTFCGLSYVGRTDPANPIYLSFQCGDNRGVA-------M 400

  Fly   145 HEFLHALGFFHQQSAADRDDYVQIVEENITEGMEFNFDKYTEETVNDFGEKYDYGSVMHYGPYAF 209
            ||.:||||..||....|||.|::|...||.......|.....:....:|.||.|.|:|||..|..
 Worm   401 HETMHALGVSHQHLRLDRDKYIKIDWSNIDPQHYDTFAISDAKLYTSYGTKYAYDSIMHYNAYLG 465

  Fly   210 SKNGER-TILALEEGKEDV--IGQRLELSETDIRKLNAIYKCP 249
            :|:..: |::.|...:|:.  :|||.:|:..|||.|..:|..|
 Worm   466 AKDPNKPTMIPLVNPQENTPKLGQRAKLTRGDIRLLKKMYCRP 508

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15253NP_609758.1 Astacin 55..250 CDD:279708 57/204 (28%)
ZnMc_astacin_like 59..246 CDD:239807 55/195 (28%)
nas-9NP_741532.1 Astacin 311..505 CDD:279708 57/209 (27%)
ZnMc_astacin_like 316..505 CDD:239807 56/204 (27%)
ShKT 510..546 CDD:214586
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10127
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.