DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15253 and toh-1

DIOPT Version :9

Sequence 1:NP_609758.1 Gene:CG15253 / 34916 FlyBaseID:FBgn0028948 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_497769.3 Gene:toh-1 / 175491 WormBaseID:WBGene00006591 Length:414 Species:Caenorhabditis elegans


Alignment Length:271 Identity:76/271 - (28%)
Similarity:117/271 - (43%) Gaps:36/271 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 SILLLL----LVVVNVAWAAPSIRIETDPELTAGYIEGDMVPSGSS-RNIWRNETYRWPNRII-- 62
            |::|:|    ||.:..|....|.:|...|.|..  :..|..|..:: ..:.|.:.:|....:|  
 Worm     4 SLVLILAPLALVAIGEAAFGNSSKIFEIPGLEV--MASDKYPHFTTIETVSRTKVHRHRREVIAG 66

  Fly    63 -YYHINSYI--------DEEHRNHIVSAIQKIESISCLTFKEATTDQKYYVNVTSEEGGCFS-YI 117
             .|..|||.        |...::.|...|:..|..:||.|||....:.....|..:...||: ||
 Worm    67 QIYDWNSYEIPFQIWGGDYNFQSLIRRGIRMWEDSTCLRFKENQQSRDAIRYVLEKGDSCFTEYI 131

  Fly   118 GYLNRVQQLNLQNNEIGVGCFRLYTIVHEFLHALGFFHQQSAADRDDYVQIVEENITEGMEFNFD 182
            |     :....|:..||..|...|.:.||..|||||:|.....|||.::.|..:|:.|....:|.
 Worm   132 G-----RNGGHQDIIIGSECAEEYVVAHETGHALGFWHTHQRPDRDRHISINWKNVMEEATASFM 191

  Fly   183 KYTEETVNDFGEK--------YDYGSVMHYGPYAFS-KNGERTILALEEGKEDVIGQRLELSETD 238
            .: ...:..||.:        |||||:|||...|.: |..:.||:..|......:|.. :::..|
 Worm   192 PF-RSMLQAFGIRQVSPRRVPYDYGSLMHYHAVAHAVKVSDFTIVPKELKYVTTMGTE-KMAFLD 254

  Fly   239 IRKLNAIYKCP 249
            .:.:|.|| ||
 Worm   255 AKVINDIY-CP 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15253NP_609758.1 Astacin 55..250 CDD:279708 63/216 (29%)
ZnMc_astacin_like 59..246 CDD:239807 58/207 (28%)
toh-1NP_497769.3 Astacin 71..265 CDD:279708 60/202 (30%)
ZnMc_astacin_like 73..262 CDD:239807 55/195 (28%)
CUB 320..410 CDD:214483
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D681837at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.