DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15253 and nas-25

DIOPT Version :9

Sequence 1:NP_609758.1 Gene:CG15253 / 34916 FlyBaseID:FBgn0028948 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_495880.1 Gene:nas-25 / 174412 WormBaseID:WBGene00003544 Length:399 Species:Caenorhabditis elegans


Alignment Length:207 Identity:62/207 - (29%)
Similarity:111/207 - (53%) Gaps:15/207 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 RNIWRNETYRWPNRIIYYHINSYIDEEHRNHIVSAIQKIESISCLTFKEATTDQKY----YVNVT 107
            |.:.|:.||||||..:.|::.: :....:..:..||:::::.:|:.|:  ..::||    .|.:.
 Worm    40 RQVQRDLTYRWPNNTVPYYVGN-VTSTIKKSVRLAIEELQAWTCIRFQ--NVNEKYSDGDSVRIV 101

  Fly   108 SEEGGCFSYIGYLNRVQQLNLQNNEIGVGCFRLYTIVHEFLHALGFFHQQSAADRDDYVQIVEEN 172
             :.|.|.|.||.    ||:..|:..:...|:.:.|.:||.:||:|..|.||.:||:.|:.|:.:|
 Worm   102 -DLGSCSSPIGR----QQIGTQDVSLTKNCWGMGTAIHELMHAIGIEHTQSRSDRNRYLDILAQN 161

  Fly   173 ITEGMEFNFDKYTEETVNDFGEKYDYGSVMHYGPYAFS-KNGERTILALEEGKEDVIGQRLELSE 236
            |......||:..:.....:. ..|||||||||...:|| |:.|:|:|..:....:.:|..:. :.
 Worm   162 IDNRDLPNFELLSPRLWANL-VPYDYGSVMHYSADSFSNKDDEQTMLPKDRSFIETMGSMIP-NF 224

  Fly   237 TDIRKLNAIYKC 248
            .|..::|..|:|
 Worm   225 YDFDQINQYYQC 236

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15253NP_609758.1 Astacin 55..250 CDD:279708 59/199 (30%)
ZnMc_astacin_like 59..246 CDD:239807 53/191 (28%)
nas-25NP_495880.1 Astacin 48..236 CDD:279708 58/197 (29%)
ZnMc_astacin_like 52..234 CDD:239807 53/191 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D681837at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10127
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.