Sequence 1: | NP_609758.1 | Gene: | CG15253 / 34916 | FlyBaseID: | FBgn0028948 | Length: | 253 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_492109.2 | Gene: | nas-36 / 172506 | WormBaseID: | WBGene00003552 | Length: | 617 | Species: | Caenorhabditis elegans |
Alignment Length: | 211 | Identity: | 67/211 - (31%) |
---|---|---|---|
Similarity: | 106/211 - (50%) | Gaps: | 12/211 - (5%) |
- Green bases have known domain annotations that are detailed below.
Fly 47 RNIWRNETYRWPNRIIYYHINSYIDEEHRNHIVSAIQKIESISCLTFKEAT-TDQKYYVNVTSEE 110
Fly 111 GGCFSYIGYLNRVQQLNLQNNEIGVGCFRLYTIVHEFLHALGFFHQQSAADRDDYVQIVEENITE 175
Fly 176 GMEFNFDKYTEETVNDFGEKYDYGSVMHYGPYAFSKNGE-RTILALEEGKEDVIGQRLELSETDI 239
Fly 240 RKLNAIY---KCPTVK 252 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG15253 | NP_609758.1 | Astacin | 55..250 | CDD:279708 | 64/199 (32%) |
ZnMc_astacin_like | 59..246 | CDD:239807 | 61/188 (32%) | ||
nas-36 | NP_492109.2 | Astacin | 134..323 | CDD:279708 | 63/195 (32%) |
ZnMc_astacin_like | 140..320 | CDD:239807 | 61/186 (33%) | ||
CUB | 380..478 | CDD:214483 | |||
TSP1 | 510..556 | CDD:214559 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG3714 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D681837at2759 | |
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
3 | 2.820 |