DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15253 and nas-36

DIOPT Version :9

Sequence 1:NP_609758.1 Gene:CG15253 / 34916 FlyBaseID:FBgn0028948 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_492109.2 Gene:nas-36 / 172506 WormBaseID:WBGene00003552 Length:617 Species:Caenorhabditis elegans


Alignment Length:211 Identity:67/211 - (31%)
Similarity:106/211 - (50%) Gaps:12/211 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 RNIWRNETYRWPNRIIYYHINSYIDEEHRNHIVSAIQKIESISCLTFKEAT-TDQKYYVNVTSEE 110
            |:...::|..|....|.|..:..||....:.|::||:..|..:|:||:..: :....|:...|.:
 Worm   126 RSFVSDKTATWKTMPIKYRFHESIDFYTISQIIAAIRFWEDSTCITFENVSDSPDGDYIEFFSGQ 190

  Fly   111 GGCFSYIGYLNRVQQLNLQNNEIGVGCFRLYTIVHEFLHALGFFHQQSAADRDDYVQIVEENITE 175
             ||:|.||     :....|...||..|.::..|.||..||||.:|:||..|...||.|..:.|..
 Worm   191 -GCYSMIG-----RNGGRQGISIGESCVKMGVIEHEIGHALGLWHEQSRPDALGYVTIERDFILP 249

  Fly   176 GMEFNFDKYTEETVNDFGEKYDYGSVMHYGPYAFSKNGE-RTILALEEGKEDVIGQRLELSETDI 239
            ....:|.:..:| ::..|..||.|||||||..|||.:.: :|::..:...:..||||.:||..|:
 Worm   250 SYISDFLQRDDE-IDTLGIPYDLGSVMHYGSTAFSVDQKSKTVVTRDSLYQQTIGQREKLSFYDV 313

  Fly   240 RKLNAIY---KCPTVK 252
            ..:|..|   :|.:.|
 Worm   314 ATINTAYCKDECKSEK 329

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15253NP_609758.1 Astacin 55..250 CDD:279708 64/199 (32%)
ZnMc_astacin_like 59..246 CDD:239807 61/188 (32%)
nas-36NP_492109.2 Astacin 134..323 CDD:279708 63/195 (32%)
ZnMc_astacin_like 140..320 CDD:239807 61/186 (33%)
CUB 380..478 CDD:214483
TSP1 510..556 CDD:214559
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D681837at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.