DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15253 and astl

DIOPT Version :9

Sequence 1:NP_609758.1 Gene:CG15253 / 34916 FlyBaseID:FBgn0028948 Length:253 Species:Drosophila melanogaster
Sequence 2:XP_031755136.1 Gene:astl / 101730245 XenbaseID:XB-GENE-5769376 Length:972 Species:Xenopus tropicalis


Alignment Length:225 Identity:79/225 - (35%)
Similarity:121/225 - (53%) Gaps:20/225 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 AGYIEGDMVPSGSSRNIWRNETYRWP----NRIIYYHINSYIDEEHRNHIVSAIQKIESISCLTF 93
            :|.:|||:|....|...:.....:||    :.||.|.::|..:...||.|:.|.:.:::.:||.|
 Frog    52 SGLMEGDIVKEKRSIRTFSARFAKWPKINGSVIIPYTLSSSYESFDRNIILKAFRDLQASTCLRF 116

  Fly    94 KEATTDQKYYVNVTSEEG-GCFSYIGYLNRVQQLNLQ----NNEIGVGCFRLYTIVHEFLHALGF 153
            .|.||::.|   :..|.. ||||.:|.:..:|.::|.    ..:.|.|     ..:||.:|..||
 Frog   117 VERTTERDY---IAIEPAIGCFSSVGRVGGMQLVSLAFECLRTDKGKG-----IALHELMHVAGF 173

  Fly   154 FHQQSAADRDDYVQIVEENITEGMEFNFDKYTEETVNDFGEKYDYGSVMHYGPYAFSKNGERTIL 218
            :|:.|.||||||:.|:.:.|..|.|.||.||.  |.|.. .||:..|::||...||||:|:.||.
 Frog   174 WHEHSRADRDDYIWIIWDEILIGYEKNFCKYA--TTNML-VKYELQSILHYPRSAFSKSGQATIN 235

  Fly   219 ALEEGKEDVIGQRLELSETDIRKLNAIYKC 248
            ......:..||||.:||.:||.::|.:|.|
 Frog   236 PKYPYSKIEIGQREKLSASDILRVNKLYSC 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15253NP_609758.1 Astacin 55..250 CDD:279708 73/203 (36%)
ZnMc_astacin_like 59..246 CDD:239807 69/191 (36%)
astlXP_031755136.1 ZnMc_astacin_like 84..263 CDD:239807 69/189 (37%)
MAM 817..971 CDD:99706
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D472790at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10127
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.110

Return to query results.
Submit another query.