DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15253 and astl3a.3

DIOPT Version :9

Sequence 1:NP_609758.1 Gene:CG15253 / 34916 FlyBaseID:FBgn0028948 Length:253 Species:Drosophila melanogaster
Sequence 2:XP_031746774.1 Gene:astl3a.3 / 100498584 XenbaseID:XB-GENE-22069675 Length:529 Species:Xenopus tropicalis


Alignment Length:316 Identity:100/316 - (31%)
Similarity:141/316 - (44%) Gaps:84/316 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MCYYSILLLLLVVVNVAWAAPSIRI-------------------------ETDPELTAGYIEGDM 40
            |.:...::||..::..||..|:..|                         |.|...|.|.:.|..
 Frog     3 MVHTKSIILLACIMGSAWTYPAQIIFPYQEMLEKDSLTNLDLLEALGKSAEKDALATEGTVRGME 67

  Fly    41 VP-----SGS----------SRNIWRNETYR------------------WPNR-----IIYYHIN 67
            :|     |||          :|.| |..||:                  ||..     |:.|:.:
 Frog    68 MPVLGKKSGSVDVFTQISKVNRGI-RVPTYQGDILRPKGRSAMNCTECLWPKSTDGTVIVPYNFS 131

  Fly    68 SYIDEEHRNHIVSAIQKIESISCLTF--KEATTDQKYYVNVTSEEGGCFSYIGYLNRVQQLNLQN 130
            |....:......|.:|:.||::|:.|  :...||   ::::.| :.||.|::|.:...|.:.|.:
 Frog   132 SNYSADQLALFKSTMQEYESLTCVRFVPRANETD---FLSIVS-DNGCASFLGKVGGDQTVQLDS 192

  Fly   131 NEIGVGCFRLYTIVHEFLHALGFFHQQSAADRDDYVQIVEENITEGMEFNFDKYTEETVNDFGEK 195
                .||.....|.||..|||||:|:||.:||||||.|..|||..|.|.||:|...   |:.|.:
 Frog   193 ----YGCIYRGIIQHELNHALGFYHEQSRSDRDDYVTIHTENIIPGYEGNFNKADS---NNLGLE 250

  Fly   196 YDYGSVMHYGPYAFSKNGERTILALEEGKED---VIGQRLELSETDIRKLNAIYKC 248
            |||.|||||...||||||..||:.    |.|   .||||..||..|:.|:|.:|:|
 Frog   251 YDYSSVMHYSGDAFSKNGNLTIVP----KPDPTVPIGQRDGLSILDVSKINRLYQC 302

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15253NP_609758.1 Astacin 55..250 CDD:279708 80/222 (36%)
ZnMc_astacin_like 59..246 CDD:239807 75/196 (38%)
astl3a.3XP_031746774.1 ZnMc_hatching_enzyme 121..302 CDD:239810 76/195 (39%)
CUB 306..414 CDD:238001
CUB 419..527 CDD:238001
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D472790at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.