Sequence 1: | NP_609758.1 | Gene: | CG15253 / 34916 | FlyBaseID: | FBgn0028948 | Length: | 253 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_031756322.1 | Gene: | XB5917669 / 100496293 | XenbaseID: | XB-GENE-5917670 | Length: | 578 | Species: | Xenopus tropicalis |
Alignment Length: | 256 | Identity: | 76/256 - (29%) |
---|---|---|---|
Similarity: | 119/256 - (46%) | Gaps: | 52/256 - (20%) |
- Green bases have known domain annotations that are detailed below.
Fly 30 ELTAGYIEGDMVPSG----------------------------------SSRNIWR--NETYRWP 58
Fly 59 NRIIYYHINSYIDEEHRNHIVSAIQKIESISCLTFKEATTDQKYYVNVTSEEGGCFSYIGYLNRV 123
Fly 124 QQLNLQNNEIGVGCFRLYTIVHEFLHALGFFHQQSAADRDDYVQIVEENITEGMEFNFDKYTEET 188
Fly 189 VNDFGEKYDYGSVMHYGPYAFSK-NGERTILALEEGKEDVIGQRLELSETDIRKLNAIYKC 248 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG15253 | NP_609758.1 | Astacin | 55..250 | CDD:279708 | 65/195 (33%) |
ZnMc_astacin_like | 59..246 | CDD:239807 | 62/187 (33%) | ||
XB5917669 | XP_031756322.1 | C2 | 92..>113 | CDD:417471 | 2/6 (33%) |
ZnMc | 164..346 | CDD:412141 | 67/196 (34%) | ||
CUB | 349..458 | CDD:395345 | |||
CUB | 463..574 | CDD:238001 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D472790at33208 | |
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 1 | 1.000 | - | - | ||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 2.010 |