DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15253 and XB5917669

DIOPT Version :9

Sequence 1:NP_609758.1 Gene:CG15253 / 34916 FlyBaseID:FBgn0028948 Length:253 Species:Drosophila melanogaster
Sequence 2:XP_031756322.1 Gene:XB5917669 / 100496293 XenbaseID:XB-GENE-5917670 Length:578 Species:Xenopus tropicalis


Alignment Length:256 Identity:76/256 - (29%)
Similarity:119/256 - (46%) Gaps:52/256 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 ELTAGYIEGDMVPSG----------------------------------SSRNIWR--NETYRWP 58
            ||...::||...|.|                                  |:..:|:  |||...|
 Frog   106 ELCVSFLEGKSDPFGQGDVFSRILKANQGNGVPRVQEDIAVGVSRSAITSTECLWQKTNETVYVP 170

  Fly    59 NRIIYYHINSYIDEEHRNHIVSAIQKIESISCLTFKEATTDQKYYVNVTSEEGGCFSYIGYLNRV 123
                 |.::|.......|.:.||::...:::|:.| ...||:..|||:||.: ||:||:|.....
 Frog   171 -----YTLDSKYSNSEVNTMTSAMEVYATLTCVQF-VPYTDEDDYVNITSGD-GCWSYMGRQGGA 228

  Fly   124 QQLNLQNNEIGVGCFRLYTIVHEFLHALGFFHQQSAADRDDYVQIVEENITEGMEFNFDKYTEET 188
            |.::::...    |....|.:||..|||||.|:.|.:|||:||.|:.:.|:.|...||:......
 Frog   229 QVVSVEKGY----CTSEGTTMHELNHALGFVHEHSRSDRDNYVNIMYQYISPGDIVNFEIMNTNN 289

  Fly   189 VNDFGEKYDYGSVMHYGPYAFSK-NGERTILALEEGKEDVIGQRLELSETDIRKLNAIYKC 248
            :|..   |||.|:|||..:|||. .|:.||:| :.....:||....::..||.|:|.:|:|
 Frog   290 LNTI---YDYRSIMHYPAWAFSNTTGKNTIVA-KLNPNIIIGAGSTMTSLDIIKINRLYEC 346

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15253NP_609758.1 Astacin 55..250 CDD:279708 65/195 (33%)
ZnMc_astacin_like 59..246 CDD:239807 62/187 (33%)
XB5917669XP_031756322.1 C2 92..>113 CDD:417471 2/6 (33%)
ZnMc 164..346 CDD:412141 67/196 (34%)
CUB 349..458 CDD:395345
CUB 463..574 CDD:238001
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D472790at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.