DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15253 and syt13

DIOPT Version :9

Sequence 1:NP_609758.1 Gene:CG15253 / 34916 FlyBaseID:FBgn0028948 Length:253 Species:Drosophila melanogaster
Sequence 2:XP_002937348.3 Gene:syt13 / 100496122 XenbaseID:XB-GENE-955112 Length:508 Species:Xenopus tropicalis


Alignment Length:222 Identity:75/222 - (33%)
Similarity:118/222 - (53%) Gaps:24/222 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 GDM-VPSGSSRNIWRNETYRWPNRI-----IYYHINSYIDEEHRNHIVSAIQKIESISCLTFKEA 96
            ||| :|:|.|.....::...||...     :.|.:.:..:.:.|..|.:|:.:..:::|:.| ..
 Frog    68 GDMAIPTGRSAIRCTSKDCYWPKSANGLVNVPYTLAAEYNVQDRATIAAAMLEFSTLTCIRF-VP 131

  Fly    97 TTDQKYYVNVTSEEGGCFSYIGYLNRV----QQLNLQNNEIGVGCFRLYTIVHEFLHALGFFHQQ 157
            .|:::.::|:.| :.||:|::|   |.    |.|:||..    ||.....|.||..|||||.|:.
 Frog   132 HTNERDFLNIIS-DSGCWSFLG---RAGGGGQDLSLQRG----GCLSNGIIQHELNHALGFVHEH 188

  Fly   158 SAADRDDYVQIVEENITEGMEFNFDKYTEETVNDFGEKYDYGSVMHYGPYAFSKNGE-RTILALE 221
            :.:|||.||:|...||....:.:|:|  .:|.|. |.:||||||||||..::|.:.: .||..:.
 Frog   189 TRSDRDSYVKIFWNNIQPEYKDSFNK--TDTDNQ-GMEYDYGSVMHYGRNSYSIDYQLPTIQPIP 250

  Fly   222 EGKEDVIGQRLELSETDIRKLNAIYKC 248
            .|... ||||..||..|..|:|.:|.|
 Frog   251 NGLIP-IGQRYGLSSLDAAKINRLYNC 276

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15253NP_609758.1 Astacin 55..250 CDD:279708 69/204 (34%)
ZnMc_astacin_like 59..246 CDD:239807 65/196 (33%)
syt13XP_002937348.3 ZnMc_hatching_enzyme 93..276 CDD:239810 66/195 (34%)
CUB 294..388 CDD:238001
CUB 391..504 CDD:238001
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D472790at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.