DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15253 and astl2d.5

DIOPT Version :9

Sequence 1:NP_609758.1 Gene:CG15253 / 34916 FlyBaseID:FBgn0028948 Length:253 Species:Drosophila melanogaster
Sequence 2:XP_031756347.1 Gene:astl2d.5 / 100495579 XenbaseID:XB-GENE-22069752 Length:497 Species:Xenopus tropicalis


Alignment Length:229 Identity:75/229 - (32%)
Similarity:117/229 - (51%) Gaps:32/229 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 EGDMVPS-------GSSRN-------IWRNETYRWPNRIIY--YHINSYIDEEHRNHIVSAIQKI 85
            :|:.||.       |.||:       :|:.     .|..:|  |.::........|.:.||::..
 Frog    52 QGNRVPRVQEDIAVGVSRSAITYTECLWQK-----TNGTVYVPYTLDDKYSNSEVNTMTSAMEVY 111

  Fly    86 ESISCLTFKEATTDQKYYVNVTSEEGGCFSYIGYLNRVQQLNLQNNEIGVGCFRLYTIVHEFLHA 150
            .:::|:.| ...||:..|||:||.: ||:||:|.....|.::::...    |....|.:||..||
 Frog   112 ATLTCVQF-VPYTDEDDYVNITSGD-GCWSYMGRQRGAQVVSVEKGY----CTSEGTTMHELNHA 170

  Fly   151 LGFFHQQSAADRDDYVQIVEENITEGMEFNFDKYTEETVNDFGEKYDYGSVMHYGPYAFSK-NGE 214
            |||.|:||.:|||:||.|:.:.|:.|....|.|...   |:.|..|||.|||||..:|||. .|:
 Frog   171 LGFVHEQSRSDRDNYVNIMYQYISPGDVAEFKKMES---NNLGTTYDYRSVMHYPAWAFSNTTGQ 232

  Fly   215 RTILALEEGKEDVIGQRLELSETDIRKLNAIYKC 248
            .||:| :.....:||....::..||.|:|.:|:|
 Frog   233 NTIVA-KPNPNIIIGAGNTMTSLDIIKINRLYEC 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15253NP_609758.1 Astacin 55..250 CDD:279708 68/197 (35%)
ZnMc_astacin_like 59..246 CDD:239807 66/189 (35%)
astl2d.5XP_031756347.1 ZnMc 83..265 CDD:412141 67/191 (35%)
CUB 268..377 CDD:395345
CUB 382..493 CDD:238001
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D681837at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.