DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15253 and astl2f

DIOPT Version :9

Sequence 1:NP_609758.1 Gene:CG15253 / 34916 FlyBaseID:FBgn0028948 Length:253 Species:Drosophila melanogaster
Sequence 2:XP_002934133.3 Gene:astl2f / 100495416 XenbaseID:XB-GENE-22069764 Length:624 Species:Xenopus tropicalis


Alignment Length:235 Identity:76/235 - (32%)
Similarity:123/235 - (52%) Gaps:27/235 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 IETDPELTAGYIEGDMVP--SGSSRN----IWRNETYRWPNRIIYYHINSYIDEEHRNHIVSAIQ 83
            :|.:.:.....::||::.  ..|:.|    :|...|....|  :.|.|.|..|:..:..|..|:.
 Frog   172 LEANKDTNVPLVQGDILEKLGRSTTNCTSCLWPRATSGLVN--VPYTIASVFDDSEQELIQGALN 234

  Fly    84 KIESISCLTFKEATTDQKYYVNVTSEEG-GCFSYIGYLNRVQQLNLQNNEIGVGCFRLYTIVHEF 147
            ::.::||:.||..|.:..:   ::.:.| ||:|.:|.....|::::..:    ||.....|.||.
 Frog   235 ELMTLSCIRFKARTIETDF---LSFQSGNGCWSSVGKTGGSQEVSVSKS----GCMSHGIIQHET 292

  Fly   148 LHALGFFHQQSAADRDDYVQIVEENITEGMEFNFDKYTEETVNDFGEKYDYGSVMHYGPYAFSKN 212
            ||||||.|:...:|||:||.|:.:.|:||...:|.|...   |:.|.:|||.||||||.:.|:..
 Frog   293 LHALGFIHEHCRSDRDNYVDIIYKYISEGDRSSFTKVNS---NNLGLQYDYSSVMHYGRFTFTNT 354

  Fly   213 -GERTILALEEGKEDV---IGQRLELSETDIRKLNAIYKC 248
             |:.||:.    |.|:   ||||..:|..|:.|||.:|.|
 Frog   355 PGQATIIP----KPDLSVPIGQRYGVSSLDVAKLNKLYNC 390

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15253NP_609758.1 Astacin 55..250 CDD:279708 69/199 (35%)
ZnMc_astacin_like 59..246 CDD:239807 67/191 (35%)
astl2fXP_002934133.3 ZnMc 209..390 CDD:412141 68/196 (35%)
CUB 394..504 CDD:238001
CUB 507..621 CDD:238001
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10127
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.