DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15253 and astl2a

DIOPT Version :9

Sequence 1:NP_609758.1 Gene:CG15253 / 34916 FlyBaseID:FBgn0028948 Length:253 Species:Drosophila melanogaster
Sequence 2:XP_002934118.2 Gene:astl2a / 100492493 XenbaseID:XB-GENE-5966804 Length:492 Species:Xenopus tropicalis


Alignment Length:197 Identity:60/197 - (30%)
Similarity:94/197 - (47%) Gaps:14/197 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 WPNR-----IIYYHINSYIDEEHRNHIVSAIQKIESISCLTFKEATTDQKYYVNVTSEEGGCFSY 116
            ||..     ::.|.|::.........|..|:.:..:::|:.|...:.::.:.  :...|.||||.
 Frog    76 WPKSQNGSVLVPYRISADYGVSDIESITDAMLEFSTLTCVRFVPRSAERDHV--IIRSENGCFSS 138

  Fly   117 IGYLNRVQQLNLQNNEIGVGCFRLYTIVHEFLHALGFFHQQSAADRDDYVQIVEENITEGMEFNF 181
            .|.|...|.::|...:    |.....|.||..|.||..|:.|..|||:|:.::|.||......:|
 Frog   139 KGRLGGAQTVSLLKPD----CVEFGIIQHELNHVLGLAHENSRMDRDEYITVIETNIPAEFHRDF 199

  Fly   182 DKYTEETVNDFGEKYDYGSVMHYGPYAFSKNGERTILALEEGKEDVIGQRLELSETDIRKLNAIY 246
            :|...:.|   |.:|||.||||||..|||..|..:.|..:......:||...||..|:.|:|.:|
 Frog   200 EKPESDIV---GMEYDYNSVMHYGSGAFSNTGGMSTLVPKRNPNAQLGQLYGLSNLDVSKINRLY 261

  Fly   247 KC 248
            :|
 Frog   262 EC 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15253NP_609758.1 Astacin 55..250 CDD:279708 60/197 (30%)
ZnMc_astacin_like 59..246 CDD:239807 56/191 (29%)
astl2aXP_002934118.2 ZnMc 81..263 CDD:412141 57/190 (30%)
CUB 267..377 CDD:238001
CUB 380..491 CDD:238001
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D681837at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10127
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.