DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15253 and astl3a.1

DIOPT Version :9

Sequence 1:NP_609758.1 Gene:CG15253 / 34916 FlyBaseID:FBgn0028948 Length:253 Species:Drosophila melanogaster
Sequence 2:XP_002944440.3 Gene:astl3a.1 / 100491875 XenbaseID:XB-GENE-22069668 Length:514 Species:Xenopus tropicalis


Alignment Length:238 Identity:88/238 - (36%)
Similarity:123/238 - (51%) Gaps:30/238 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 AAPSIRIETDPELTAGYIEGDMVPSGSSRNIWRNETYRWPNRI-----IYYHINSYIDEEHRNHI 78
            |...||:.|.        |||:: ....||.....:..||...     :.|:.:...:.:.....
 Frog    70 ANKDIRLPTR--------EGDII-QNPGRNAINCTSCLWPKSADGTVPVPYNFSYSYNADQLALF 125

  Fly    79 VSAIQKIESISCLTFKEATTDQKYYVNVTSEEGGCFSYIGYLNRVQQLNLQNNEIGVGCFRLYTI 143
            .:|:|:.|:::|:.|:..||:.. ::|:.| .|||.|.||.....|::.|..|    ||..:..|
 Frog   126 KTAMQEFETLTCVRFRPWTTESD-FLNIVS-NGGCASSIGKSGGAQRVALDAN----GCMSMGII 184

  Fly   144 VHEFLHALGFFHQQSAADRDDYVQIVEENITEGMEFNFDKYTEETVNDFGEKYDYGSVMHYGPYA 208
            .||..|||||:|:|:.:||||||.|..|||......||:||   ..|:.|.:|||.|||||...|
 Frog   185 EHELNHALGFYHEQNRSDRDDYVIIHPENILPDSLNNFNKY---DTNNLGTEYDYNSVMHYARDA 246

  Fly   209 FSKNGERTILALEEGKED---VIGQRLELSETDIRKLNAIYKC 248
            |||||:.||    |.|.:   .||||..||..||.|:|.:|.|
 Frog   247 FSKNGKATI----EPKPNPNVPIGQRNGLSVLDISKINKLYGC 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15253NP_609758.1 Astacin 55..250 CDD:279708 79/202 (39%)
ZnMc_astacin_like 59..246 CDD:239807 75/194 (39%)
astl3a.1XP_002944440.3 ZnMc_hatching_enzyme 104..285 CDD:239810 76/193 (39%)
CUB 289..397 CDD:238001
CUB 402..512 CDD:238001
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D472790at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.