DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15253 and mep1ba

DIOPT Version :9

Sequence 1:NP_609758.1 Gene:CG15253 / 34916 FlyBaseID:FBgn0028948 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_001070089.2 Gene:mep1ba / 100151009 ZFINID:ZDB-GENE-041014-209 Length:677 Species:Danio rerio


Alignment Length:267 Identity:98/267 - (36%)
Similarity:136/267 - (50%) Gaps:29/267 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 CYYSILLLLLVVVNVAWAAPSIRIETDPELTAGY-----------------IEGD-MVPSGSSRN 48
            |.|   |.|.|.|.|. ..|:..:..|.|:...:                 :||| ::..|.|||
Zfish     5 CSY---LFLSVCVTVL-CLPTSSVTGDTEIDVDHGTDLDIFEINEVAGLDLVEGDILIEEGESRN 65

  Fly    49 IWRNETYRWPNRIIYYHINSYIDEEHRNHIVSAIQKIESISCLTFKEATTDQKYYVNVTSEEGGC 113
            ....|.||||..:.|:..|| ::...:..|:.|.::....:|:.||....:..|.  ...:..||
Zfish    66 TILGEQYRWPTTVPYFLDNS-LEINAKGVILKAFEQYRLKTCIDFKPWNGESNYI--FVFKGSGC 127

  Fly   114 FSYIGYLNRVQQLNLQNNEIGVGCFRLYTIVHEFLHALGFFHQQSAADRDDYVQIVEENITEGME 178
            :|.:|  ||  |:..|...||..|..|.|:.||||||||.:|:||.:||||||.||.:.|.:|.|
Zfish   128 YSKVG--NR--QMGKQELSIGSNCDSLGTVEHEFLHALGLWHEQSRSDRDDYVIIVWDQIQDGKE 188

  Fly   179 FNFDKYTEETVNDFGEKYDYGSVMHYGPYAFSKNGERTILALEEGKEDVIGQRLELSETDIRKLN 243
            .||:.|.|...:..|..|||.|||||...:|:|..|.||:.......:|||||:|.|:.|:.|||
Zfish   189 HNFNLYDETQSSSLGVPYDYSSVMHYSKTSFNKGSEPTIVTKIPEFLNVIGQRMEFSDNDLLKLN 253

  Fly   244 AIYKCPT 250
            .:|.|.|
Zfish   254 RLYNCTT 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15253NP_609758.1 Astacin 55..250 CDD:279708 79/194 (41%)
ZnMc_astacin_like 59..246 CDD:239807 73/186 (39%)
mep1baNP_001070089.2 ZnMc_meprin 29..258 CDD:239809 87/235 (37%)
Astacin 72..260 CDD:279708 79/194 (41%)
MAM 268..432 CDD:279023
MAM 268..430 CDD:99706
MATH_Meprin_Beta 430..599 CDD:239751
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10127
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.