DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15253 and mep1b

DIOPT Version :9

Sequence 1:NP_609758.1 Gene:CG15253 / 34916 FlyBaseID:FBgn0028948 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_001096352.1 Gene:mep1b / 100124942 XenbaseID:XB-GENE-1001365 Length:722 Species:Xenopus tropicalis


Alignment Length:214 Identity:86/214 - (40%)
Similarity:126/214 - (58%) Gaps:10/214 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 EGDMVPSGSS-RNIWRNETYRWPNRIIYYHINSYIDEEHRNHIVSAIQKIESISCLTFKEATTDQ 100
            |||::.:.:: ||....:.||||..:.|: :...::...:..::.|.::....:|:.|| ....:
 Frog    50 EGDIILADTNQRNSIIGDRYRWPIPVPYF-LEDSLEINAKALVLEAFERYRLKTCIDFK-PWEGE 112

  Fly   101 KYYVNVTSEEGGCFSYIGYLNR-VQQLNLQNNEIGVGCFRLYTIVHEFLHALGFFHQQSAADRDD 164
            ..|::| .::.||:||:|.|.: .|||:|     ||.|.|:.||.|||||||||:|:||.|||||
 Frog   113 PNYISV-FKDSGCYSYVGNLRQGKQQLSL-----GVNCDRIATIQHEFLHALGFWHEQSRADRDD 171

  Fly   165 YVQIVEENITEGMEFNFDKYTEETVNDFGEKYDYGSVMHYGPYAFSKNGERTILALEEGKEDVIG 229
            ||.||.:.|..|.|.||:.|.:...|.....|||.|||||...||....|.||:...:...||||
 Frog   172 YVTIVWDRILPGREHNFNVYDDTRSNSLNVPYDYTSVMHYSKTAFQNGSEPTIVTKIDAFSDVIG 236

  Fly   230 QRLELSETDIRKLNAIYKC 248
            ||::.|:.|:.|||.:|.|
 Frog   237 QRMDFSDYDLEKLNRLYNC 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15253NP_609758.1 Astacin 55..250 CDD:279708 81/195 (42%)
ZnMc_astacin_like 59..246 CDD:239807 75/187 (40%)
mep1bNP_001096352.1 ZnMc 26..255 CDD:412141 85/212 (40%)
MAM 265..428 CDD:395504
MATH 427..590 CDD:351761
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 145 1.000 Domainoid score I4540
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10127
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.