DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15254 and Tnfaip6

DIOPT Version :9

Sequence 1:NP_001285959.1 Gene:CG15254 / 34915 FlyBaseID:FBgn0028949 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_445834.1 Gene:Tnfaip6 / 84397 RGDID:621359 Length:275 Species:Rattus norvegicus


Alignment Length:140 Identity:31/140 - (22%)
Similarity:51/140 - (36%) Gaps:27/140 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    77 RNHILRGIRIIEQSSCLVFKEATTDQEYYVNVTSEAGGCYSYVGYRNRVQQLNLQTYALDTGCFR 141
            :|.|......:||::.:..:||...:  |....:||.....|.|.|       |.||.      :
  Rat    21 KNGIFHNSIWLEQAAGVYHREARAGR--YKLTYAEAKAVCEYEGGR-------LATYK------Q 70

  Fly   142 LGTIVHEFLHALGFYHQQSTWNRDDYVRIAEENITEGTEGNFNKYDNETVEDYGEPYDYSSVLHY 206
            |     |....:||:...:.|....  |:....:..|....|.|   ..:.|||...:.|.  .:
  Rat    71 L-----EAARKIGFHVCAAGWMAKG--RVGYPIVKPGPNCGFGK---TGIIDYGIRLNRSE--RW 123

  Fly   207 TAYAFSKNGE 216
            .||.::.|.:
  Rat   124 DAYCYNPNAK 133

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15254NP_001285959.1 Astacin 58..251 CDD:279708 31/140 (22%)
ZnMc_astacin_like 61..248 CDD:239807 31/140 (22%)
Tnfaip6NP_445834.1 Link_domain_TSG_6_like 36..128 CDD:239592 26/118 (22%)
CUB 135..244 CDD:395345
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.