DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15254 and he1.3

DIOPT Version :9

Sequence 1:NP_001285959.1 Gene:CG15254 / 34915 FlyBaseID:FBgn0028949 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_001091658.1 Gene:he1.3 / 792176 ZFINID:ZDB-GENE-040518-1 Length:271 Species:Danio rerio


Alignment Length:267 Identity:76/267 - (28%)
Similarity:124/267 - (46%) Gaps:36/267 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LTLVVIFLAS------SCSAAPTTQN-----RIETDPELTAGYIEGDMVPSPEGRNGL---RNET 56
            |.||.|.||:      :.:...|.||     .:||:...:...|||||: .|:.||.|   .|..
Zfish    11 LLLVGISLAAPVGEYDNSNGIETPQNVDITTLLETNKGSSRRLIEGDML-YPQTRNALVCGNNNC 74

  Fly    57 FRWPNRI-----VYYYINRDIDTEHRNHILRGIRIIEQSSCLVF--KEATTDQEYYVNVTSEAGG 114
            | |....     |.|.::.:......:.|.:.:..|...:|:.|  :.:.||   |:::.:: .|
Zfish    75 F-WKKNSSNFVEVPYIVSSEYSATEISVIQKAMSGIHNKTCIRFVPRISQTD---YISIENQ-DG 134

  Fly   115 CYSYVGYRNRVQQLNLQTYALDTGCFRLGTIVHEFLHALGFYHQQSTWNRDDYVRIAEENITEGT 179
            |::::|.....|.::|:    ..||.....:.||..|||||||:....:||.|:.|..|.|....
Zfish   135 CFAFIGKNGGKQLVSLR----KKGCVYHSIVQHELNHALGFYHEHVRSDRDSYITIHWEYIATNE 195

  Fly   180 EGNFNKYDNETVEDYGEPYDYSSVLHYTAYAFSK-NGEMTIVPLQEGAEELMGQRLQMTQSDINK 243
            ..||.|   :........|||.|::||...||:. .|:.|:.|..:....: |:..:|:..||.:
Zfish   196 IRNFMK---KNTNSQNTTYDYGSIMHYGKTAFTTVKGKETMTPYPDETVPI-GKAKEMSDIDILR 256

  Fly   244 LNVMYKC 250
            :|:||.|
Zfish   257 INMMYSC 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15254NP_001285959.1 Astacin 58..251 CDD:279708 54/201 (27%)
ZnMc_astacin_like 61..248 CDD:239807 50/194 (26%)
he1.3NP_001091658.1 ZnMc 82..263 CDD:294052 52/192 (27%)
Astacin 86..264 CDD:279708 53/190 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D472790at33208
OrthoFinder 1 1.000 - - FOG0000240
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.