DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15254 and c6ast1

DIOPT Version :9

Sequence 1:NP_001285959.1 Gene:CG15254 / 34915 FlyBaseID:FBgn0028949 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_001036784.1 Gene:c6ast1 / 751088 ZFINID:ZDB-GENE-070621-1 Length:260 Species:Danio rerio


Alignment Length:266 Identity:91/266 - (34%)
Similarity:141/266 - (53%) Gaps:39/266 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LVVIFLASSCSAAPTTQNRIETDPELTAGYIE------GDMVPSPEGRNG-------------LR 53
            ||:.||.||..|...|   ||.|....:..:|      |:.:..|....|             ..
Zfish     5 LVICFLLSSFEAQSRT---IEQDIISASALMERPSNFAGEELDEPSIMFGDIAVGTPLDITAPCT 66

  Fly    54 NETFRWP---NRIVY--YYINRDIDTEHRNHILRGIRIIEQSSCLVFKEATTDQEYYVNVTSEAG 113
            .::.:||   |..|:  |.|:.:..|:.::.|.:|.|.:|:|:|:.|:..||.:: |:|:...: 
Zfish    67 GQSCKWPLSSNGKVFVPYIISDEYSTQEKDVIFQGFRSLEKSTCVRFRPRTTQRD-YINIEPNS- 129

  Fly   114 GCYSYVGYRNRVQQLNLQTYALD-TGCFRLGTIVHEFLHALGFYHQQSTWNRDDYVRIAEENITE 177
            ||||:||.|.     ..||.:|| .||.:|..:.||.||.|||:|:.:..:||.:|:|..:||..
Zfish   130 GCYSFVGRRT-----GGQTVSLDHDGCIKLNIVQHELLHTLGFHHEHNRSDRDSHVQIVYKNIIP 189

  Fly   178 GTEGNFNKYDNETVEDYGEPYDYSSVLHYTAYAFSKNGEMTIVPLQEGAEELMGQRLQMTQSDIN 242
            |.|.||:|.....:|   ..||||||:||..:|||||.|.||||:.:....: |:..:|:.:||.
Zfish   190 GQERNFDKIKTNNLE---TAYDYSSVMHYGRFAFSKNKEATIVPIPDSGVTI-GRAKRMSSNDIL 250

  Fly   243 KLNVMY 248
            ::|.:|
Zfish   251 RINRLY 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15254NP_001285959.1 Astacin 58..251 CDD:279708 76/197 (39%)
ZnMc_astacin_like 61..248 CDD:239807 73/189 (39%)
c6ast1NP_001036784.1 Astacin 71..259 CDD:279708 76/197 (39%)
ZnMc_hatching_enzyme 77..257 CDD:239810 74/191 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D472790at33208
OrthoFinder 1 1.000 - - FOG0000240
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10127
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
55.020

Return to query results.
Submit another query.