DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15254 and CG34370

DIOPT Version :9

Sequence 1:NP_001285959.1 Gene:CG15254 / 34915 FlyBaseID:FBgn0028949 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_001097404.2 Gene:CG34370 / 5740565 FlyBaseID:FBgn0085399 Length:952 Species:Drosophila melanogaster


Alignment Length:155 Identity:33/155 - (21%)
Similarity:54/155 - (34%) Gaps:37/155 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 VPSPEGRNGLRNETFRWPNRIVYYYINRDIDTEHRNHILRGIRIIEQSSCLVFKEATTDQEYYVN 107
            :.|||    :.|:....|  :..:|..|.:....|:.:||          |.||:....|  .:|
  Fly    88 ISSPE----VSNQNVGRP--LTCWYRFRTLKGAPRDFVLR----------LRFKKFKVGQ--LLN 134

  Fly   108 VTSEAGGCYSYVGYRNRVQQLNLQTYALDTGCFRLGTIVHEFLHALGFYHQQSTW-NRDDYVRIA 171
            .|...||....|....:....|.:    :.|.|            .|...|..|: :...||::.
  Fly   135 ATHCEGGYLQIVDGNAKTDVSNRR----EPGMF------------CGEAEQPQTFISETSYVKVL 183

  Fly   172 --EENITEGTEGNFNKYDNETVEDY 194
              .:|.|:.|...|:....:..|.|
  Fly   184 FHTDNFTDQTYFTFDSRAEQQTEVY 208

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15254NP_001285959.1 Astacin 58..251 CDD:279708 29/140 (21%)
ZnMc_astacin_like 61..248 CDD:239807 28/137 (20%)
CG34370NP_001097404.2 CUB 88..195 CDD:238001 30/140 (21%)
CUB 244..363 CDD:238001
CUB 407..509 CDD:238001
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45444875
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.