DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15254 and c6ast4

DIOPT Version :9

Sequence 1:NP_001285959.1 Gene:CG15254 / 34915 FlyBaseID:FBgn0028949 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_001020351.1 Gene:c6ast4 / 574001 ZFINID:ZDB-GENE-050626-100 Length:265 Species:Danio rerio


Alignment Length:191 Identity:73/191 - (38%)
Similarity:115/191 - (60%) Gaps:15/191 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 PNRIVYYYINRDIDTEHRNHILRGIRIIEQSSCLVFKEATTDQEYYVNVTSEAGGCYSYVGYRNR 124
            |..|..:|.:|:::.     |.||:......||:.|...:.::: |:::.|.: |||||||.:..
Zfish    90 PYVIANHYSSRELEI-----IQRGLDSFASVSCIRFFRRSNERD-YISIESRS-GCYSYVGRQGN 147

  Fly   125 VQQLNLQTYALDTGCFRLGTIVHEFLHALGFYHQQSTWNRDDYVRIAEENITEGTEGNFNKYDNE 189
            ||.::|..    :||....|:.||.||||||.|:|:..:||:::::..|||.:..:.||||.:  
Zfish   148 VQTVSLAR----SGCLYHSTVQHELLHALGFNHEQTRSDRDNHIQVIWENILDDMKYNFNKIN-- 206

  Fly   190 TVEDYGEPYDYSSVLHYTAYAFSKNGEMTIVPLQEGAEELMGQRLQMTQSDINKLNVMYKC 250
             ..:.|.||||.||:.|..|||||||..|::|:.....|| |:..||:|:||.:||.:|:|
Zfish   207 -TLNQGTPYDYKSVMQYERYAFSKNGYPTMIPIPNNNAEL-GKSTQMSQNDITRLNRLYQC 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15254NP_001285959.1 Astacin 58..251 CDD:279708 73/191 (38%)
ZnMc_astacin_like 61..248 CDD:239807 70/186 (38%)
c6ast4NP_001020351.1 Astacin 78..265 CDD:279708 72/189 (38%)
ZnMc 84..265 CDD:294052 72/189 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D472790at33208
OrthoFinder 1 1.000 - - FOG0000240
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10127
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.