DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15254 and bmp1a

DIOPT Version :9

Sequence 1:NP_001285959.1 Gene:CG15254 / 34915 FlyBaseID:FBgn0028949 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_001035126.1 Gene:bmp1a / 572452 ZFINID:ZDB-GENE-060818-1 Length:986 Species:Danio rerio


Alignment Length:197 Identity:67/197 - (34%)
Similarity:106/197 - (53%) Gaps:8/197 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 WPNRIVYYYINRDIDTEHRNHILRGIRIIEQSSCLVFKEATTDQEYYVNVTSEAGGCYSYVGYRN 123
            ||..::.|.|:.:.....|....:.:|..|:.:|:.|.|.||::.|.| .|....||.||||.|.
Zfish   119 WPEGVIPYVISGNFSGSQRAIFRQAMRHWEKHTCVTFIERTTEESYIV-FTYRPCGCCSYVGRRG 182

  Fly   124 RVQQLNLQTYALDTGCFRLGTIVHEFLHALGFYHQQSTWNRDDYVRIAEENITEGTEGNFNKYDN 188
            .    ..|..::...|.:.|.:|||..|.:||:|:.:..:||::|.|..:||..|.|.||.|.:.
Zfish   183 G----GPQAISIGKNCDKFGIVVHELGHVIGFWHEHTRPDRDEHVSIIRDNIQPGQEYNFLKMEP 243

  Fly   189 ETVEDYGEPYDYSSVLHYTAYAFSKNGEM-TIVPLQE--GAEELMGQRLQMTQSDINKLNVMYKC 250
            ..|:..||.||:.|::||....||:...: ||:|..:  |....:|||.::::.||.:...:|||
Zfish   244 GEVDSLGEVYDFDSIMHYARNTFSRGIFLDTILPRYDVNGVRPPIGQRTRLSKGDIAQARKLYKC 308

  Fly   251 PR 252
            ||
Zfish   309 PR 310

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15254NP_001285959.1 Astacin 58..251 CDD:279708 64/194 (33%)
ZnMc_astacin_like 61..248 CDD:239807 60/189 (32%)
bmp1aNP_001035126.1 ZnMc_BMP1_TLD 112..309 CDD:239808 64/194 (33%)
Astacin 117..309 CDD:279708 64/194 (33%)
CUB 311..420 CDD:278839 67/197 (34%)
CUB 424..533 CDD:278839
FXa_inhibition 544..576 CDD:291342
CUB 580..699 CDD:278839
FXa_inhibition 706..741 CDD:291342
CUB 746..855 CDD:278839
CUB 859..972 CDD:278839
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.