DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15254 and he1.1

DIOPT Version :9

Sequence 1:NP_001285959.1 Gene:CG15254 / 34915 FlyBaseID:FBgn0028949 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_001038639.1 Gene:he1.1 / 569018 ZFINID:ZDB-GENE-021211-3 Length:263 Species:Danio rerio


Alignment Length:236 Identity:76/236 - (32%)
Similarity:119/236 - (50%) Gaps:19/236 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 TQNRIETDPELTAGYIEGDMVPSPEGRNGL--RNETFRW---PNRIVY--YYINRDIDTEHRNHI 80
            |...:||:...:....|||:| .|:.||..  .:::..|   .|.||.  |.::.:.....::.|
Zfish    39 TAQILETNKGSSEVLFEGDVV-LPKNRNAFICEDKSCFWKKNANNIVEVPYVVSGEFSINDKSVI 102

  Fly    81 LRGIRIIEQSSCLVFKEATTDQEYYVNVTSEAGGCYSYVGYRNRVQQLNLQTYALDTGCFRLGTI 145
            ...|.|....:|:.|...:. |..|:::.:: .||||.:|.....|.::|..    .||...|..
Zfish   103 ANAISIFHAQTCIRFVPRSI-QADYLSIENK-DGCYSAIGRTGGKQVVSLNR----KGCVYSGIA 161

  Fly   146 VHEFLHALGFYHQQSTWNRDDYVRIAEENITEGTEGNFNKYDNETVEDYGEPYDYSSVLHYTAYA 210
            .||..|||||||:||..:||.||||...||:.|...||.|   :...:...||||.|::||...|
Zfish   162 QHELNHALGFYHEQSRSDRDQYVRINWNNISPGMAYNFLK---QKTNNQNTPYDYGSLMHYGKTA 223

  Fly   211 FS-KNGEMTIVPLQEGAEELMGQRLQMTQSDINKLNVMYKC 250
            |: :.|..||.|:.:...:: |||..:::.||.::|.:|.|
Zfish   224 FAIQPGLETITPIPDENVQI-GQRQGLSKIDILRINKLYGC 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15254NP_001285959.1 Astacin 58..251 CDD:279708 66/199 (33%)
ZnMc_astacin_like 61..248 CDD:239807 63/189 (33%)
he1.1NP_001038639.1 ZnMc_hatching_enzyme 81..263 CDD:239810 64/191 (34%)
Astacin 86..263 CDD:279708 61/186 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D472790at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10127
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.