DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15254 and bmp1b

DIOPT Version :9

Sequence 1:NP_001285959.1 Gene:CG15254 / 34915 FlyBaseID:FBgn0028949 Length:254 Species:Drosophila melanogaster
Sequence 2:XP_005155463.1 Gene:bmp1b / 559877 ZFINID:ZDB-GENE-060818-2 Length:970 Species:Danio rerio


Alignment Length:259 Identity:76/259 - (29%)
Similarity:122/259 - (47%) Gaps:44/259 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 SSCSAAPTTQNRIETDPELTAGYIEGDMVPSPEGRNG-----LRNETFR-------------WPN 61
            ||.|:.|.:.||                  |...||.     |.|::..             |||
Zfish    69 SSGSSKPDSVNR------------------SSANRNAKDEPVLANQSILRRRRAATARPERVWPN 115

  Fly    62 RIVYYYINRDIDTEHRNHILRGIRIIEQSSCLVFKEATTDQEYYVNVTSEAGGCYSYVGYRNRVQ 126
            .|:.|.|:.:.....|....:.:|..|:.:|:.|.|.:.::.|.| .|....||.|:||.|..  
Zfish   116 GIIPYIISGNFTGSQRAIFKQAMRHWEKHTCVTFVERSVEESYIV-FTLRPCGCCSFVGRRGG-- 177

  Fly   127 QLNLQTYALDTGCFRLGTIVHEFLHALGFYHQQSTWNRDDYVRIAEENITEGTEGNFNKYDNETV 191
              ..|..::...|.:.|.:|||..|.:||:|:.:..:||::|.|..|||..|.|.||.|.:.:.|
Zfish   178 --GPQAISIGKNCDKFGIVVHELGHVIGFWHEHTRPDRDEHVDIFRENIQPGQEYNFIKMEPDDV 240

  Fly   192 EDYGEPYDYSSVLHYTAYAFSKNGEM-TIVPLQ--EGAEELMGQRLQMTQSDINKLNVMYKCPR 252
            :..||.||:.|::||....||:...: |::|..  :|....:|||.::::.||.:...:|:|||
Zfish   241 DSLGEVYDFDSIMHYARNTFSRGIYLDTMLPKYDVDGVRPPIGQRTRLSKGDIAQARKLYRCPR 304

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15254NP_001285959.1 Astacin 58..251 CDD:279708 62/208 (30%)
ZnMc_astacin_like 61..248 CDD:239807 59/189 (31%)
bmp1bXP_005155463.1 ZnMc_BMP1_TLD 109..303 CDD:239808 62/198 (31%)
Astacin 111..303 CDD:279708 62/196 (32%)
CUB 305..414 CDD:278839 76/259 (29%)
CUB 418..527 CDD:278839
EGF_CA 530..570 CDD:214542
CUB 575..684 CDD:278839
FXa_inhibition 691..726 CDD:291342
CUB 731..840 CDD:278839
CUB 844..957 CDD:278839
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.