DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15254 and tll2l

DIOPT Version :9

Sequence 1:NP_001285959.1 Gene:CG15254 / 34915 FlyBaseID:FBgn0028949 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_001016661.1 Gene:tll2l / 549415 XenbaseID:XB-GENE-478930 Length:500 Species:Xenopus tropicalis


Alignment Length:269 Identity:71/269 - (26%)
Similarity:120/269 - (44%) Gaps:36/269 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 VVIFLASSCSAAP--TTQNRIETDPELTA-----GYIEGDMVPSPEG---------------RNG 51
            ::|.|.:..::.|  |.:..:|:|.....     ..|...::.|.||               |:.
 Frog     9 IIICLVTYATSLPLTTLEKPLESDDHQETHKPNDADIFTQIIASNEGIDQLLLQGDIAIRVVRSS 73

  Fly    52 LRNETFRWP----NRI-VYYYINRDIDTEHRNHILRGIRIIEQSSCLVFKEATTDQEYYVNVTSE 111
            |:.:..:|.    .:: |.:.::..........|...::..|..:|:.|...|.::. .:|: :.
 Frog    74 LQCDNCKWDISSNGKVPVPFTVSPGYTKSQLALITAAMQEFETLTCVDFVPKTNEKN-VINI-NN 136

  Fly   112 AGGCYSYVGYRNRVQQLNLQTYALDTGCFRLGTIVHEFLHALGFYHQQSTWNRDDYVRIAEENIT 176
            ..||:||:|....|||::|...:    |...|.|.||..|.|||.|:....:||.||.:.::||.
 Frog   137 GNGCWSYIGRSGGVQQVSLSKQS----CMVKGIIQHELNHVLGFVHEHVRSDRDQYVNVVKKNIL 197

  Fly   177 EGTEGNFNKYDNETVEDYGEPYDYSSVLHYTAYAFSKNGEMTIVPLQEGAEELMGQRLQMTQSDI 241
            ..:.|||   |.....:.|.||||.||:||...|||.:..:..:..:......:|||..:|..||
 Frog   198 PDSLGNF---DIAVTNNLGLPYDYYSVMHYPRNAFSISPFLPTLITKPDPTIQIGQRYGLTNLDI 259

  Fly   242 NKLNVMYKC 250
            .|:|.:|.|
 Frog   260 AKINKLYNC 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15254NP_001285959.1 Astacin 58..251 CDD:279708 59/198 (30%)
ZnMc_astacin_like 61..248 CDD:239807 56/187 (30%)
tll2lNP_001016661.1 ZnMc_hatching_enzyme 86..268 CDD:239810 57/190 (30%)
CUB 272..382 CDD:238001
CUB 385..495 CDD:238001
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D681837at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10127
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
44.020

Return to query results.
Submit another query.