DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15254 and tld

DIOPT Version :9

Sequence 1:NP_001285959.1 Gene:CG15254 / 34915 FlyBaseID:FBgn0028949 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_524487.2 Gene:tld / 42945 FlyBaseID:FBgn0003719 Length:1067 Species:Drosophila melanogaster


Alignment Length:196 Identity:58/196 - (29%)
Similarity:100/196 - (51%) Gaps:8/196 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 WPNRIVYYYINRDIDTEHRNHILRGIRIIEQSSCLVFKEATTD-QEYYVNVTSEAGGCYSYVGYR 122
            |...::.|.|:......|:....:.:|..|..:|:.|.|...: ...|:..|.:..||.|::|..
  Fly   146 WDYGVIPYEIDTIFSGAHKALFKQAMRHWENFTCIKFVERDPNLHANYIYFTVKNCGCCSFLGKN 210

  Fly   123 NRVQQLNLQTYALDTGCFRLGTIVHEFLHALGFYHQQSTWNRDDYVRIAEENITEGTEGNFNKYD 187
            ..    ..|..::...|.:.|.|:||..|.:||:|:.:..:||.::.|.:.||..|.|.||:...
  Fly   211 GN----GRQPISIGRNCEKFGIIIHELGHTIGFHHEHARGDRDKHIVINKGNIMRGQEYNFDVLS 271

  Fly   188 NETVEDYGEPYDYSSVLHYTAYAFSKNGEM-TIVP--LQEGAEELMGQRLQMTQSDINKLNVMYK 249
            .|.|:....|||.:|::||...:|||:..: ||.|  :..|....:|||.::::.||.:.|::||
  Fly   272 PEEVDLPLLPYDLNSIMHYAKNSFSKSPYLDTITPIGIPPGTHLELGQRKRLSRGDIVQANLLYK 336

  Fly   250 C 250
            |
  Fly   337 C 337

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15254NP_001285959.1 Astacin 58..251 CDD:279708 58/196 (30%)
ZnMc_astacin_like 61..248 CDD:239807 54/190 (28%)
tldNP_524487.2 ZnMc_BMP1_TLD 137..338 CDD:239808 58/196 (30%)
Astacin 144..339 CDD:279708 58/196 (30%)
CUB 388..474 CDD:214483
CUB 478..586 CDD:278839
FXa_inhibition 595..630 CDD:291342
CUB 634..750 CDD:278839
FXa_inhibition 757..792 CDD:291342
CUB 797..906 CDD:278839
CUB 910..1023 CDD:278839
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45444933
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3714
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10127
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.