Sequence 1: | NP_001285959.1 | Gene: | CG15254 / 34915 | FlyBaseID: | FBgn0028949 | Length: | 254 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001287510.1 | Gene: | tok / 42944 | FlyBaseID: | FBgn0004885 | Length: | 1464 | Species: | Drosophila melanogaster |
Alignment Length: | 200 | Identity: | 65/200 - (32%) |
---|---|---|---|
Similarity: | 106/200 - (53%) | Gaps: | 12/200 - (6%) |
- Green bases have known domain annotations that are detailed below.
Fly 59 WPNRIVYYYINRDIDTEHRNHILRGIRIIEQSSCLVFKEATTDQEY---YVNVTSEAGGCYSYVG 120
Fly 121 YRNRVQQLNLQTYALDTGCFRLGTIVHEFLHALGFYHQQSTWNRDDYVRIAEENITEGTEGNFNK 185
Fly 186 YDNETVEDYGEPYDYSSVLHYTAYAFSKNGEM-TIVPLQEGAEEL--MGQRLQMTQSDINKLNVM 247
Fly 248 YKCPR 252 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG15254 | NP_001285959.1 | Astacin | 58..251 | CDD:279708 | 63/197 (32%) |
ZnMc_astacin_like | 61..248 | CDD:239807 | 60/192 (31%) | ||
tok | NP_001287510.1 | ZnMc_BMP1_TLD | 520..721 | CDD:239808 | 63/197 (32%) |
Astacin | 527..721 | CDD:279708 | 63/197 (32%) | ||
CUB | 723..836 | CDD:294042 | 65/199 (33%) | ||
CUB | 840..951 | CDD:278839 | |||
FXa_inhibition | 958..993 | CDD:291342 | |||
CUB | 997..1111 | CDD:278839 | |||
FXa_inhibition | 1118..1153 | CDD:291342 | |||
CUB | 1158..1267 | CDD:278839 | |||
CUB | 1271..1390 | CDD:238001 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C45444857 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG3714 | |
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 1 | 0.950 | - | 0 | Normalized mean entropy | S3510 |
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | P | PTHR10127 |
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
5 | 4.790 |