DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15254 and tok

DIOPT Version :9

Sequence 1:NP_001285959.1 Gene:CG15254 / 34915 FlyBaseID:FBgn0028949 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_001287510.1 Gene:tok / 42944 FlyBaseID:FBgn0004885 Length:1464 Species:Drosophila melanogaster


Alignment Length:200 Identity:65/200 - (32%)
Similarity:106/200 - (53%) Gaps:12/200 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 WPNRIVYYYINRDIDTEHRNHILRGIRIIEQSSCLVFKEATTDQEY---YVNVTSEAGGCYSYVG 120
            |...::.|.|:.:....|:......:|..|.|:|:.|.|  .|.|.   |:..|..:.||.|:||
  Fly   529 WDYGVIPYEIDGNFSGIHKALFKLAMRHWENSTCIKFVE--RDPEIHPNYIVFTVRSCGCCSFVG 591

  Fly   121 YRNRVQQLNLQTYALDTGCFRLGTIVHEFLHALGFYHQQSTWNRDDYVRIAEENITEGTEGNFNK 185
            .|..    ..|..::...|.:.|.:|||..|.:||:|:.:..:|:.:|.|...||.:|.:.|||.
  Fly   592 KRGN----GPQAISIGRNCDKFGIVVHELGHVVGFWHEHTRPDREKHVVIEHNNIMKGQDYNFNM 652

  Fly   186 YDNETVEDYGEPYDYSSVLHYTAYAFSKNGEM-TIVPLQEGAEEL--MGQRLQMTQSDINKLNVM 247
            ...:.|:..|..|||.|::||....|||...: ||:|::....:.  :||||:::|.||.:.|::
  Fly   653 LSPDEVDSLGMAYDYDSIMHYARNTFSKGTYLDTILPIEMKGRKRPEIGQRLRLSQGDIAQANLL 717

  Fly   248 YKCPR 252
            ||||:
  Fly   718 YKCPK 722

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15254NP_001285959.1 Astacin 58..251 CDD:279708 63/197 (32%)
ZnMc_astacin_like 61..248 CDD:239807 60/192 (31%)
tokNP_001287510.1 ZnMc_BMP1_TLD 520..721 CDD:239808 63/197 (32%)
Astacin 527..721 CDD:279708 63/197 (32%)
CUB 723..836 CDD:294042 65/199 (33%)
CUB 840..951 CDD:278839
FXa_inhibition 958..993 CDD:291342
CUB 997..1111 CDD:278839
FXa_inhibition 1118..1153 CDD:291342
CUB 1158..1267 CDD:278839
CUB 1271..1390 CDD:238001
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45444857
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3714
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S3510
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10127
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.790

Return to query results.
Submit another query.