DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15254 and CG5715

DIOPT Version :9

Sequence 1:NP_001285959.1 Gene:CG15254 / 34915 FlyBaseID:FBgn0028949 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_651242.1 Gene:CG5715 / 42895 FlyBaseID:FBgn0039180 Length:295 Species:Drosophila melanogaster


Alignment Length:231 Identity:81/231 - (35%)
Similarity:127/231 - (54%) Gaps:15/231 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 DPELTAGYIEGD-MVPSP------EG-RNGLRNETFRWPNRIVYYYINRDIDTEHRNHILRGIRI 86
            :||....|.||| ::|..      .| |||:...:.|||..:|.|.|.....::...:|....:.
  Fly    68 NPEELGTYHEGDILIPLSYRDARFNGTRNGILALSSRWPGGVVPYEIKGPFTSQELGNINHAFKE 132

  Fly    87 IEQSSCLVFKEATTDQEYYVNVTSEAGGCYSYVGYRNRVQQLNLQTYALDTGCFR-LGTIVHEFL 150
            ....:|:.||..||::: |:::.|...||:|.:|.....|::|||:    ..|.| .||.:||.:
  Fly   133 YHTKTCVRFKPRTTEKD-YISIGSGKSGCWSSIGRLGGRQEVNLQS----PNCLRTYGTPIHELM 192

  Fly   151 HALGFYHQQSTWNRDDYVRIAEENITEGTEGNFNKYDNETVEDYGEPYDYSSVLHYTAYAFSKNG 215
            |||||:|:|:...||.|||:.::||......||.|..:.|...:|..|||.||:||:..:|::||
  Fly   193 HALGFFHEQNRHERDSYVRVMKDNIKPEMMVNFEKSSSRTQYGFGVEYDYGSVMHYSPTSFTRNG 257

  Fly   216 EMTIVPLQEGAE-ELMGQRLQMTQSDINKLNVMYKC 250
            :.|:..|:..:: ..||||...:..|:.|:|.||||
  Fly   258 QPTLKALRATSDASQMGQRKGFSAGDVRKINAMYKC 293

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15254NP_001285959.1 Astacin 58..251 CDD:279708 70/195 (36%)
ZnMc_astacin_like 61..248 CDD:239807 63/188 (34%)
CG5715NP_651242.1 Astacin 104..295 CDD:279708 70/195 (36%)
ZnMc_astacin_like 107..291 CDD:239807 63/188 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45444902
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3714
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D115954at6960
OrthoFinder 1 1.000 - - FOG0000240
OrthoInspector 1 1.000 - - otm25214
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10127
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
76.850

Return to query results.
Submit another query.