DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15254 and CG6763

DIOPT Version :9

Sequence 1:NP_001285959.1 Gene:CG15254 / 34915 FlyBaseID:FBgn0028949 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_001262871.1 Gene:CG6763 / 42754 FlyBaseID:FBgn0039069 Length:354 Species:Drosophila melanogaster


Alignment Length:240 Identity:90/240 - (37%)
Similarity:130/240 - (54%) Gaps:19/240 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 TQNRI--------ETDPELTAGYIEGDM-VPSPE--GRNGLRNETFRWPNRIVYYYINRDIDTEH 76
            |.||:        |.:||....|:|||| ||..:  .:|||..::.||||.:|.|.|..:.:...
  Fly    70 TANRVGNFSADADEMNPEELGSYLEGDMLVPQTDLIMKNGLPTQSSRWPNGVVPYEIRGNFNARD 134

  Fly    77 RNHILRGIRIIEQSSCLVFKEATTDQEYYVNVTSEAGGCYSYVGYRNRVQQLNLQTYALDTGCF- 140
            ...|...|....:.:|:.|.:.::::: |:::..:..||:|.||.....|::|||:    .||. 
  Fly   135 MATIENAIGEYHRRTCIRFVKRSSERD-YISIRGDNSGCWSSVGRVGGKQEVNLQS----PGCLS 194

  Fly   141 RLGTIVHEFLHALGFYHQQSTWNRDDYVRIAEENITEGTEGNFNKYDNETVEDYGEPYDYSSVLH 205
            |.||.:||.:|||||.|:|:...||.||.|...|:......||.|  ....|.:|.||||.||:|
  Fly   195 RPGTAMHELMHALGFLHEQNRMERDGYVAIQYNNVQSSAMNNFEK--AARTEAFGVPYDYGSVMH 257

  Fly   206 YTAYAFSKNGEMTIVPLQEGAEELMGQRLQMTQSDINKLNVMYKC 250
            |:..|||.||:.||:.:|....:.||||...:..||.|||.||.|
  Fly   258 YSKNAFSINGQPTILAMQANGADKMGQRNGFSDYDIQKLNRMYDC 302

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15254NP_001285959.1 Astacin 58..251 CDD:279708 74/194 (38%)
ZnMc_astacin_like 61..248 CDD:239807 68/187 (36%)
CG6763NP_001262871.1 Astacin 116..304 CDD:279708 74/194 (38%)
ZnMc_astacin_like 119..300 CDD:239807 68/187 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45444935
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3714
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D115954at6960
OrthoFinder 1 1.000 - - FOG0000240
OrthoInspector 1 1.000 - - otm25214
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10127
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
76.850

Return to query results.
Submit another query.