DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15254 and MEP1B

DIOPT Version :10

Sequence 1:NP_609757.1 Gene:CG15254 / 34915 FlyBaseID:FBgn0028949 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_005916.2 Gene:MEP1B / 4225 HGNCID:7020 Length:701 Species:Homo sapiens


Alignment Length:257 Identity:87/257 - (33%)
Similarity:133/257 - (51%) Gaps:17/257 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 TWALTLVVIFLASSCSAAPTT--------QNRIETDPELTAGYIEGDM-VPSPEGRNGLRNETFR 58
            :|.|.|..:.:.|.. |.|..        |:..:.:..|.....|||: :...:.||.:..|.:|
Human     7 SWFLFLDALLVISGL-ATPENFDVDGGMDQDIFDINEGLGLDLFEGDIRLDRAQIRNSIIGEKYR 70

  Fly    59 WPNRIVYYYINRDIDTEHRNHILRGIRIIEQSSCLVFKEATTDQEYYVNVTSEAGGCYSYVGYRN 123
            ||:.|. |.:...::...:..||.........:|:.|| ....:..|::| .:..||:|.||.| 
Human    71 WPHTIP-YVLEDSLEMNAKGVILNAFERYRLKTCIDFK-PWAGETNYISV-FKGSGCWSSVGNR- 131

  Fly   124 RVQQLNLQTYALDTGCFRLGTIVHEFLHALGFYHQQSTWNRDDYVRIAEENITEGTEGNFNKYDN 188
               ::..|..::...|.|:.|:.|||||||||:|:||..:|||||||..:.|..|.|.|||.|.:
Human   132 ---RVGKQELSIGANCDRIATVQHEFLHALGFWHEQSRSDRDDYVRIMWDRILSGREHNFNTYSD 193

  Fly   189 ETVEDYGEPYDYSSVLHYTAYAFSKNGEMTIVPLQEGAEELMGQRLQMTQSDINKLNVMYKC 250
            :..:....||||:||:||:..||....|.|||......|:::|||:..:.||:.|||.:|.|
Human   194 DISDSLNVPYDYTSVMHYSKTAFQNGTEPTIVTRISDFEDVIGQRMDFSDSDLLKLNQLYNC 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15254NP_609757.1 ZnMc_astacin_like 61..248 CDD:239807 68/186 (37%)
MEP1BNP_005916.2 ZnMc_meprin 26..255 CDD:239809 80/235 (34%)
MAM 265..428 CDD:459878
MATH 427..586 CDD:445786
Required for proteolytic processing 595..607
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.