DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15254 and CG10280

DIOPT Version :9

Sequence 1:NP_001285959.1 Gene:CG15254 / 34915 FlyBaseID:FBgn0028949 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_001246942.1 Gene:CG10280 / 40740 FlyBaseID:FBgn0037395 Length:362 Species:Drosophila melanogaster


Alignment Length:235 Identity:76/235 - (32%)
Similarity:120/235 - (51%) Gaps:17/235 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 DPELTAGYIEGDMVPSPE-------GRNGLRNETFRWPNRIVYYYINRDIDTEHRNHILRGIRII 87
            |||......:||:...|.       |.|.:|:....|||..:.:.|:.....:.|..|::.::..
  Fly   113 DPETMPRLFQGDIAIDPYTYITLRLGVNPMRHPKRLWPNGTIPFEISPRYANQERQAIIQAVKTF 177

  Fly    88 EQSSCLVFKEATTDQEYYVNV---TSEAGGCYSYVGYRNRVQQLNLQTYALDTG-CFRL-GTIVH 147
            ...:|:.|.....:.:.|:.:   .....||:||||.|...|.::||....::. ||.. |.|:|
  Fly   178 NSLTCVHFVPYDGEVDDYLLIEPPLEGPQGCWSYVGRRGGEQVVSLQRPDENSAHCFSSEGRIMH 242

  Fly   148 EFLHALGFYHQQSTWNRDDYVRIAEENITEGTEGNFNKYDNETVEDYGEPYDYSSVLHYTAYAFS 212
            |.:||:|.||:||..:||::|:|..:||......|| |..::....|...|||:||:||..:.||
  Fly   243 ELMHAIGIYHEQSRADRDNFVKIHWDNIVPRFRKNF-KLVSKKKGKYAFDYDYNSVMHYGEFYFS 306

  Fly   213 K-NGEM-TIVPLQEGAEELMGQRLQMTQSDINKLNVMYKC 250
            | .||. |:.|||.|..  :|||..:::.|..|:|.:|.|
  Fly   307 KRKGEKPTMTPLQPGVR--IGQRKTISKIDCLKINELYGC 344

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15254NP_001285959.1 Astacin 58..251 CDD:279708 67/200 (34%)
ZnMc_astacin_like 61..248 CDD:239807 63/193 (33%)
CG10280NP_001246942.1 Astacin 147..344 CDD:279708 66/199 (33%)
ZnMc_astacin_like 151..342 CDD:239807 63/193 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45444904
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3714
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D115954at6960
OrthoFinder 1 1.000 - - FOG0000240
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10127
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.