DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15254 and nas-39

DIOPT Version :9

Sequence 1:NP_001285959.1 Gene:CG15254 / 34915 FlyBaseID:FBgn0028949 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_001360030.1 Gene:nas-39 / 3565986 WormBaseID:WBGene00003555 Length:928 Species:Caenorhabditis elegans


Alignment Length:194 Identity:67/194 - (34%)
Similarity:104/194 - (53%) Gaps:6/194 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 WPNRIVYYYINRDIDTEHRNHILRGIRIIEQSSCLVFKEATTDQEYYVNVTSEAGGCYSYVGYRN 123
            ||..|:.:.|..:...||::..||.:|..|..:|:.|.......::|:..|.:..||.||||.|.
 Worm    57 WPEGIIPFVIASNFSGEHQHLFLRAMRHWENFTCVSFVPRQPHHKHYITFTVDKCGCCSYVGRRG 121

  Fly   124 RVQQLNLQTYALDTGCFRLGTIVHEFLHALGFYHQQSTWNRDDYVRIAEENITEGTEGNFNKYDN 188
            .    ..|..::...|.:.|.:|||..|.:||:|:.:..:||.||.|..::|..|.:.||.|...
 Worm   122 E----GPQAISIGKNCDKFGIVVHELGHVVGFWHEHTRPDRDMYVDIFYKSIQTGQDYNFEKSKP 182

  Fly   189 ETVEDYGEPYDYSSVLHYTAYAFSKNGEM-TIVPLQEGAEEL-MGQRLQMTQSDINKLNVMYKC 250
            |.|:..|||||:||::||....||:.... ||:|.......| :|||:|:::.||.:...:|||
 Worm   183 EEVDSLGEPYDFSSIMHYARDTFSRGAFYDTILPKPNSGFRLEIGQRVQLSEGDIRQTKKLYKC 246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15254NP_001285959.1 Astacin 58..251 CDD:279708 67/194 (35%)
ZnMc_astacin_like 61..248 CDD:239807 62/188 (33%)
nas-39NP_001360030.1 ZnMc_BMP1_TLD 48..247 CDD:239808 67/194 (35%)
CUB 268..343 CDD:214483
CUB 359..474 CDD:238001
FXa_inhibition 480..515 CDD:373209
CUB 519..622 CDD:366096
FXa_inhibition 629..664 CDD:373209
CUB 669..780 CDD:238001
CUB 782..898 CDD:238001
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S3510
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.760

Return to query results.
Submit another query.