DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15254 and CG7631

DIOPT Version :9

Sequence 1:NP_001285959.1 Gene:CG15254 / 34915 FlyBaseID:FBgn0028949 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_609760.1 Gene:CG7631 / 34919 FlyBaseID:FBgn0028945 Length:254 Species:Drosophila melanogaster


Alignment Length:254 Identity:124/254 - (48%)
Similarity:164/254 - (64%) Gaps:1/254 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKTWALTLVVIFLASSCSAAPTTQNRIETDPELTAGYIEGDMVPSPEGRNGLRNETFRWPNRIVY 65
            ::.|....::..|.|....||...:..||||||||||.:||| .....|||..:||.||||..|.
  Fly     2 IRVWFQLFLLGTLCSGIFPAPFNTHYDETDPELTAGYFQGDM-DVDYARNGQLSETRRWPNATVP 65

  Fly    66 YYINRDIDTEHRNHILRGIRIIEQSSCLVFKEATTDQEYYVNVTSEAGGCYSYVGYRNRVQQLNL 130
            |.|:.:.|..|..:|..|::.||.|||:.|..|..|:|.|:.|.....||.|.|||:...:.:.|
  Fly    66 YRISEEFDAPHVEYIKLGMQFIEYSSCIRFVPADEDEENYLFVLPSTSGCSSKVGYQPGERTVKL 130

  Fly   131 QTYALDTGCFRLGTIVHEFLHALGFYHQQSTWNRDDYVRIAEENITEGTEGNFNKYDNETVEDYG 195
            :..:||||||:||||.||.||.|||:|||.:.|||::|:|.||||:||.|.||.||:.:.|.|:.
  Fly   131 KPGSLDTGCFKLGTIQHELLHTLGFHHQQCSPNRDEFVKIVEENISEGHEKNFVKYEEDEVGDFD 195

  Fly   196 EPYDYSSVLHYTAYAFSKNGEMTIVPLQEGAEELMGQRLQMTQSDINKLNVMYKCPRQV 254
            :||||.|:|||::.|||.|||.|||.|....:|.|||||.|:.:|:.:||.|||||.|:
  Fly   196 QPYDYGSILHYSSLAFSINGEATIVALNPEGQEQMGQRLMMSDTDVKRLNTMYKCPIQL 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15254NP_001285959.1 Astacin 58..251 CDD:279708 98/192 (51%)
ZnMc_astacin_like 61..248 CDD:239807 92/186 (49%)
CG7631NP_609760.1 Astacin 57..251 CDD:279708 98/193 (51%)
ZnMc_astacin_like 61..248 CDD:239807 92/186 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45444898
Domainoid 1 1.000 145 1.000 Domainoid score I4540
eggNOG 1 0.900 - - E1_KOG3714
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG49330
OrthoDB 1 1.010 - - D109979at50557
OrthoFinder 1 1.000 - - FOG0000240
OrthoInspector 1 1.000 - - mtm9716
orthoMCL 1 0.900 - - OOG6_112325
Panther 1 1.100 - - P PTHR10127
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
109.760

Return to query results.
Submit another query.