DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15254 and CG11865

DIOPT Version :9

Sequence 1:NP_001285959.1 Gene:CG15254 / 34915 FlyBaseID:FBgn0028949 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_609759.1 Gene:CG11865 / 34917 FlyBaseID:FBgn0028947 Length:240 Species:Drosophila melanogaster


Alignment Length:253 Identity:96/253 - (37%)
Similarity:129/253 - (50%) Gaps:27/253 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LTLVVIF-LASSCSAAPTTQNRIETDPELTAG----YIEGDMVPSPEGRNGLRNETFRWPNR-IV 64
            |.|.||| |.||.:..|:.  :::.|..:...    |.||::    |||.......:.|..| :|
  Fly     4 LALAVIFGLGSSANGRPSI--KLQEDDIILISEQLQYFEGNL----EGRVVKSWSEYYWKGRTLV 62

  Fly    65 YYYI----NRDIDTEHRNHILRGIRIIEQSSCLVFKEATTDQEYYVNVTSEAGGCYSYVGYRNRV 125
            |.|.    :.||.:     |...:..|...:|:.|:.....:|..|.:..|..||:|||||..|.
  Fly    63 YSYAGGFSSLDIAS-----IESAMAEISSKTCVKFRRTEYKREPQVVIQKEGSGCWSYVGYLGRA 122

  Fly   126 QQLNLQTYALDTGCFRLGTIVHEFLHALGFYHQQSTWNRDDYVRIAEENITEGTEGNFNKYDNET 190
            .    ||..|.:||....||.||.||||||:|..|...||.||||..:||..|.|.||.:.....
  Fly   123 D----QTLNLGSGCMSNRTIQHELLHALGFFHTHSDPQRDKYVRIQTDNIRSGHEHNFQRLRANG 183

  Fly   191 VEDYGEPYDYSSVLHYTAYAFSKNGEMTIVPLQEGAEELMGQRLQMTQSDINKLNVMY 248
            |.:||..|||.|::||..:||||||:.|||||:..|:  :||..||:..|:..|..||
  Fly   184 VTNYGFGYDYDSIMHYGPFAFSKNGQSTIVPLKSHAK--IGQATQMSPKDVQTLKRMY 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15254NP_001285959.1 Astacin 58..251 CDD:279708 80/196 (41%)
ZnMc_astacin_like 61..248 CDD:239807 77/191 (40%)
CG11865NP_609759.1 Astacin 56..239 CDD:279708 78/193 (40%)
ZnMc_astacin_like 58..239 CDD:239807 77/191 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45444827
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3714
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG49330
OrthoDB 1 1.010 - - D109979at50557
OrthoFinder 1 1.000 - - FOG0000240
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10127
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
76.860

Return to query results.
Submit another query.