DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15254 and CG6696

DIOPT Version :9

Sequence 1:NP_001285959.1 Gene:CG15254 / 34915 FlyBaseID:FBgn0028949 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_573318.1 Gene:CG6696 / 32856 FlyBaseID:FBgn0030947 Length:324 Species:Drosophila melanogaster


Alignment Length:216 Identity:90/216 - (41%)
Similarity:125/216 - (57%) Gaps:8/216 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 GYIEGDMVPSPE-GRNGLRNETFRWPNRIVYYYIN-RDIDTEHRNHILRGIRIIEQSSCLVFKEA 98
            |..|||::...| .||||.||...||...|.:||: :|.:......||:..:.....:|:.|:..
  Fly    81 GLFEGDIMLHRELLRNGLLNERLTWPEAAVPFYIDPQDFNANQTMVILKAFKEYHDRTCIRFRPY 145

  Fly    99 TTDQEYYVNVTSEAGGCYSYVGYRNRVQQLNLQTYALDTGCFRLGTIVHEFLHALGFYHQQSTWN 163
            ....::::.:.....||:|.||.|:..|.|||.|    ..|...|.:|||.|||||||||||...
  Fly   146 EQGDKHWLLIKGNYSGCWSSVGRRSGGQVLNLNT----PKCVTHGVVVHELLHALGFYHQQSATE 206

  Fly   164 RDDYVRIAEENITEGTEGNFNKYDNETVEDYGEPYDYSSVLHYTAYAFSKNGEMTIVPLQEGAEE 228
            ||:||:|..|||.:|...|||||....:.::|..|||.||:||::.||||||:.||.||...|. 
  Fly   207 RDEYVKINWENILDGHAHNFNKYARTHITNFGVEYDYQSVMHYSSRAFSKNGKATIEPLDPYAS- 270

  Fly   229 LMGQRLQMTQSDINKLNVMYK 249
             :|||..::..|::|||.||:
  Fly   271 -LGQRRGLSDKDVSKLNEMYE 290

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15254NP_001285959.1 Astacin 58..251 CDD:279708 79/193 (41%)
ZnMc_astacin_like 61..248 CDD:239807 75/187 (40%)
CG6696NP_573318.1 Astacin 104..295 CDD:279708 79/193 (41%)
ZnMc_astacin_like 110..289 CDD:239807 75/184 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45444900
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3714
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG49330
OrthoDB 1 1.010 - - D109979at50557
OrthoFinder 1 1.000 - - FOG0000240
OrthoInspector 1 1.000 - - otm25214
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10127
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
87.860

Return to query results.
Submit another query.