DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15254 and mep1bb

DIOPT Version :9

Sequence 1:NP_001285959.1 Gene:CG15254 / 34915 FlyBaseID:FBgn0028949 Length:254 Species:Drosophila melanogaster
Sequence 2:XP_009294699.1 Gene:mep1bb / 327586 ZFINID:ZDB-GENE-030131-5797 Length:774 Species:Danio rerio


Alignment Length:265 Identity:95/265 - (35%)
Similarity:144/265 - (54%) Gaps:30/265 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LTLVVIFLASSCSAAPTTQNRIE-----TDPELTAG--------------YIEGDMV-PSPEGRN 50
            |..:::|:::.|.   .||..||     |:..:..|              ..|||:: ....|||
Zfish    13 LVYLLLFVSARCE---VTQRLIECVTSSTEYNVDGGKEDLFDVNEDAGLDLFEGDILYDETLGRN 74

  Fly    51 GLRNETFRWPNRIVYYYINRDIDTEHRNHILRGIRIIEQSSCLVFKEATTDQEYYVNVTSEAGGC 115
            .:..|.:|||..|.||: ..|::...:..||:........:|:.:| ..|.:|.|::| .:..||
Zfish    75 SIIGEEYRWPKTIPYYF-EDDLEINAKGVILKAFEQYRLKTCIDYK-PWTGEENYISV-FKGNGC 136

  Fly   116 YSYVGYRNRVQQLNLQTYALDTGCFRLGTIVHEFLHALGFYHQQSTWNRDDYVRIAEENITEGTE 180
            :|.||.|    ::..||.::.:||.|:.||.|||||||||:|:||..:|||||.|..:.||||.|
Zfish   137 FSSVGNR----RVGRQTLSIGSGCDRIATIEHEFLHALGFWHEQSRSDRDDYVSIMWDRITEGKE 197

  Fly   181 GNFNKYDNETVEDYGEPYDYSSVLHYTAYAFSKNGEMTIVPLQEGAEELMGQRLQMTQSDINKLN 245
            .|||||::.:......||||||::||:..||....|.||:........::|||::.:.||:.|||
Zfish   198 HNFNKYNDSSSSALNVPYDYSSMMHYSQKAFQSGSEPTIITRIPAFSSVIGQRMEFSDSDLLKLN 262

  Fly   246 VMYKC 250
            .:|.|
Zfish   263 RLYNC 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15254NP_001285959.1 Astacin 58..251 CDD:279708 79/193 (41%)
ZnMc_astacin_like 61..248 CDD:239807 74/186 (40%)
mep1bbXP_009294699.1 ZnMc 39..267 CDD:294052 86/234 (37%)
Astacin 81..269 CDD:279708 79/194 (41%)
MAM 277..441 CDD:279023
MAM 277..440 CDD:99706
MATH 440..608 CDD:295307
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm25214
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10127
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.