Sequence 1: | NP_001285959.1 | Gene: | CG15254 / 34915 | FlyBaseID: | FBgn0028949 | Length: | 254 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_218313.7 | Gene: | Adgrg6 / 308376 | RGDID: | 1308551 | Length: | 1248 | Species: | Rattus norvegicus |
Alignment Length: | 235 | Identity: | 37/235 - (15%) |
---|---|---|---|
Similarity: | 68/235 - (28%) | Gaps: | 109/235 - (46%) |
- Green bases have known domain annotations that are detailed below.
Fly 48 GRNGLRNETFRWPNRIVYYYINRDIDTEHRNHILRGIRIIEQSSCLVFKEATTDQEYYVNVTSEA 112
Fly 113 GGCYSYVGYRNRVQQLNLQTYALDTGCFRLGTIVHEFLHALGFYHQ-----------------QS 160
Fly 161 TWNRD---DYVRIAEENITEGTEGNFNKYDNETVEDYGEPYDYSSVLHYTAYAFSKN-------- 214
Fly 215 ----------------------GEMT-IVPLQEGAEELMG 231 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG15254 | NP_001285959.1 | Astacin | 58..251 | CDD:279708 | 32/225 (14%) |
ZnMc_astacin_like | 61..248 | CDD:239807 | 32/222 (14%) | ||
Adgrg6 | XP_218313.7 | CUB | 38..146 | CDD:238001 | |
LamG | 178..337 | CDD:304605 | |||
GPS | 799..844 | CDD:280071 | |||
7tm_4 | 861..1108 | CDD:304433 | 17/115 (15%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG3714 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |